ELF@4I 4 (444444   G HHHDDPtdx ::Qtd/lib/ld-linux.so.2GNUGNU'@FHNOPSTZ^bdijlmopqrux|}  !#%&(*+-.12569<>?@BCFGHKLNOTW]^`bfijmnoqrstxz{|~   "%')*+-3456789;?BCFHKMPSTWZ[\_`abegjkmoprstwz}  "$&)*/134689;<?ABDFGJNQW\^`cfgijpqsx}    !#%&,-0256<>?ABDHLOQTUWY[\_dghimnqstuwy{~  !#%')+,-.278;=?BH J>?B JN։]Bz?X}I:d\nFĹ@6\YZ *I)vyd5> ,YkFk @h32|uF suk|{0$ёZZb7[ӪˈpRDF8uw"G)-q߼)6ϚyuS#ɵ8!p睎d/ PW2ZE~n&QMpdx?kV[RBX#jbm`=hÛu 8`Hٳ\fٝZ) rcO?@ ] Ck 4bŞR QpAHΧ I1)u92 `ԵqhPDyQ/UBE[ \q{$-dK#a~JP;7cMu1$~dxB,_v֞MyيS4/B:.H B|$(yia1:IHiF8ȬK],JD47*Q/߁ _UG ߄t"?E';tv^ : ؓ* +4j=s8R+SwݍU"n hJ3ak\ho'>lL(5Q/ Yɼh^k_ұ'&%L ʵwp50Mr53Bn` ++p/n@6=Mr_b^pt]WA#&46YU`Dp[`0TrsVȣ Nlh{:un a6FEt3N  rj,/Y\3?H't *?xy^JWBjǏpxOȪ3V++gF1FcxYp MI{ oهC R!ڸPgUap;F'쵛’qsCVWKZ`ODpG1z<kKNsŏ=a'#WJf֍/_Sw*־"$y+WҀr'&$$ws/6Gc' iN6ʦ؂U設'dԳ%͹U_5ajUfd3z;`} ?,XNQ4`R16hye WACP] #%<1 JLЀ}վzDC m mXD\l0zx>5.&LSe&wy}_X1$ ,ង_V~p˥D'cj{ٛ͊$3?S]jd~ Y앺̋h<6.{} {EXJ5%:-jS6E斮P16wbr Ͼ//Ze.@o`M!жLdYIsgҥa'ހTBo !w-`2.Y]?YcGHb;+ e cpaR'&6=g ڰ7,zQ-qPCIsJ4NG",沥Q>0oGLx,$pqX*;gn55gfxl ][1q^+NY} n;& "VM*֖&ߥ,mcL_ٳTϫc_ {Vf$)Nd>Hf}gsU'*2^- "+~r.WihtY~>YLB<#4=%-IlG}[|=!Ċ{5T*5êoJ^僝X@Vn[pE΃K&CVZsJ ؊tjEv* Z֚W\q)zkIhf_i{Zgmx[]VUgqNpóAV=[eAC!*:fVqL_wu;dq! ~(wn8(޽i\9 KӢ3)Yگ5儏gwʇE;\5ϱ% "p'*m_}쏢pj.h:Eb>2۝,1/; ]TYy 2v]%bAIa{頇̟(=J/֬$n@j*qsQbKu8D@6# NmDmЁfFUjttC[]XW⣼,!Y8[\>۲R.[bm/7tVرAX(R-w@]ay`ÏCSw,ʿjl&j~űJ6!@ZrFmN<]'$ ]oj)"(DP<w*ԲȠpKlFI7F<@*3Ջ9{wM1]|,uB8T1BHW8;JPB;r_Alj:{5EQ1j댏n%5A @?74 ;E8~0yv ǮDw2:{'(lR^D$2Rf~KxVr.,rX;,ԁuYE"Сy W6=*sKx-t%pxBJd#y Tw$rHu$>l2*s\I{?$M@#c{h00"j推r!]Ѵc‚GӳYj18c/5ר8z?5i VaGiwʼn͢I> $3[͒СJF6ű}=0Ɠ?mMl'09Ut^FMpBg]wlU&t. =߇tcV*Y*}!K@R nb*|TiG6&L 6(FƵW 򚾜m úJ<1tg2y | H0$ѣ&0}_MD*Ď 6%kͼ *Bҵ^2w5Ryv5 go7\'tw ūp7b-Xn"' 8{l$QTwܐ+{SOq83-c`ך>@y 9q&_ I٬#ki܊5:CbIˬϐ Mʝ\W_SZ)g^/$e")3k |>8^SGZU"B`@f:u`5 FCgQ3@z?P_sY(i \4Y9N'!7kP#7d )d"4Zm"w>/"2X )n=\v,6ŪA%\]*ӹyNjehC QƴrKx֍)h[(BqA*;m *:i)|t:qӣ;,G$tC.QzXKNӂޔs 'aWQ:ByPK"s(i OG:_K DE4^ 7ڱ qp͠'yksz98# :YF߼SMrb$<@g".M~G1,W! DČˎ®.e.y=}3N7׊E]"yj'DNϷWueBSYyʁiY_v=o/b&RE:{De _rR3:Nȟ-cK^浑㦜ĆlUayBF&uƱ$x`i(Kdz4 bȻD3T Tn>oQ)XMNKOPA蠒J٦}9/4 Ce{;l#"|mԯߘ[|;$ N@6Q+A+*GfY^ E^@2ir!9/ Y5vʓoMǾkqa 4}e\;,MS|12˼ b|IeՌ/- =7- vn#|,5'wiDZ/ͬZ[{ta`2BTOYL/J8}j+ZVnίۇXiPrFS$N}F/χd]F獔;>._+:;k &飞L-tv)*Gz^(m}A@^jPrO5^q6N|{17>.H8)_1|D%I'Υ{ ;Ũh49 w9RU--Cj8EK|^ ?_+[YvGrUYgVp̈j zx䫐L|<ض Pnh^:ǁ6#ХD9)[jP%.t) Q]WР>o!ܙ9U xm!hIG $|87q_ ~)7pfx%Yjʊߎ_ϾJih}ufy9T|Li(!*^lok CT+V\o1U^KQ4sܿNbAY-j-ϞÑ׀{N-i$+sŚ^ry4𱑶7e2N^q5ΰw8,zZ/)lZsKnμ66ih2W-RH a֛[]j~R%5rZ'=>y?z= Gy۬*Iv4&B8!w'c.sf?jߗ?'|=:qa~v8a 4 ~gܸ#atoȘw0SqnFثA`(^ "Om}-2Y&Y#)  >wLGNY 3$MYgp%2FBNGXj:u+9to-uzH  `dDyyVJ N   y|k+R*h?{s8QSo ,u1"kdbPe75 wFA*_5AQ@ 0l=_QQD {#*1LM  .Z 2 k " M@v  I V7 G =1 S 4 Z  N= $ EG , w&1!E / 90f   @ ! oef`  D V  X й  xS`C  D .R / Va $ b$& J f0u  wF * KPz  P xp; ty I }j  @W ! l&uJ` ~ YyX  j g ? R H 3 IG pZ  !`>   RD3 W V   r 0 A ) _ NbX[pj  xZ &d |M  OȞ. D I Rz@ 4 tTi  I0hv`b 5ȝ2o7$: 'qp R eyG< sQ  :] o@J*03x 7U4 H b8 G cG , P$@}D Wb  h! SN@U s : P[ p ! " y >]  mP 8`G \80U  ^{ Z )n@ ~ < U- 6 v0  $= K`   )'D}4  m ] "  @# Hh/H (X^ C /p ~ w x@i R & > A \ hk 0f # uPm#V c@ {PU   > ] vC;@  Zpv,wj / \ h9t u  I@_F@ ( ax;  q[@ 7 %  ОD0h 4pp  x  yP\s L  {Q@ } `g '  /H<h \ o0e a *z M KE M Q  v $B + ,P . fL pH >  #M >  % "0 n $&`WP# jDl7r ]V 3 D 7 ) cy0" `   z@    $2`R [ 4 { 2J  fP+ :~& @/ _W i :* ?H  '`J _ Sq]p ^ =T.(` Z{ 1 }v G r|ph  E0  ` ' ~ e x   * S 2@ip Z ^  _HVd@" -+ Y Up o +`_ 7 Zr{& P @ xE PJ 1m@  W?@  V J!X  ;,_ 2 Y \ T `$ $b ,7* s~ s * 6,3UdP[4D ph V -v GA o l`$:YPL  vr G2 ,  6 P 0  (|&Q 4 ?  `0 M &3<&P. ( V9q 4 /:?%6 eH7k   )uPP  2y  f& # l yR 7 ~@ A' q= * l>o^`, q l  &Epk h zms  V6% # X~PM g.cf M Vn hPc^       ?@ = #J\ 4   58C k3 5   K ;H y DV0/ # 4+E .@0 /  f]O -Q@ P  /( gJB(wYhH; .\  4  O  V ,   Y, " L` (ZP L c  Fd .0  6 ^  m0w </0& ;^Q M & lp`m n 6 0P@ #0= fG@y  U$tP[ 3  ^+0  ' -p B CO 80J X.@5 30H ? C` c?0  #0" H  aiW # %  af0 8   i x  ~о  L+h k6x A |>DTr` v ,8 N KP c$%#a@ | t $ VuPP 0W "p   \ , +% "  H u :\T&wThD*  r L |$XU&B > &A47`^@G Cu4#3F  J|$o  P4| #0a e"p / ,` R<<;X  ^  50s ( 9P`!@ ! $\0K 9M  a3  L 2_` H0 J -. f /pTs XR > D{o >Xd >mZ !p 4 #@l y z1h&W`  a%H  ] c   jx  %8O 8BY  *0  ;@  q _ )pl  & d &j h x+~ jp}4 {a p J S N 2&Bp bZTh%jX?-0#O] M P   aU  k v A@' $ } a   8;l&1pA  Ln  @"pKP&mL@ . T=  `*n +~! _z < Ct0 c&+N$cd  w < "G ? >b  $ 5 U f 0M 5 *)P 4 6 3 hELbH  spG  "W; MZ/ 1p\P F 2k  _|  M c |< U<XT} Rpg `G  { Py s?U Gg  Uo K & c:`& { %P ~ F Z PcV C@Wz \kF $ O ,!` K:G L~ 7.  M>pe i xIp  :PE  HN@    | qD   (*mpY U0]  pM > @ M L >0 Bp$ L P 7 7$p b;^E fP  x (f  (CL  > E P g 8 P 1 ag   _nC IP7  _Qp  b0W  T+ lp6 {YRU [S@m  #k 7 7pX ^m0 1 m&  I@' $ W}e 3'` d%|!`T cC&c}A p 4 R0SV | m F0A  Ĝ y h$-a s .oL 3H 9r ) |Pk   a /"90 D K  1H  Og! @ } "L G R5 P}=f * ZH n `Tj  Yy j$(wJ ~ ` !5 x[| l) ,! 5E + % e  .`I 40  P h  :|@} /pQ A ;x  PPb   C 9 [  +sx&vp  o@q" ]Jg ~p  zT up 0z  @ j Z  Cc  v d   BH  8d`  Y2!a*(.MЬ  0` &K  %  10 1p6  :P C 2  Au$7`  C) BT0  fY@J  u}s - X4PW" ;6  C J `;  [#W ?gA  | K M`0c r>  b B 4 i{ W C\p  nd *   +X2 e [ % Wc LBQ Z (lk;N"GP 9 (N %K  x D 8C h `pZ&""p f ?B  s_ v  K0K  tw@  `  a @ > 6   a(PW Z  ]&p "pF  J2` t dpX , ~0 ]Bp^ r rn`!3 B R C #S 7 \`b  #4`( )Z5 0ph  QPKB @_  N0UYа$ %#  0& gX0 V/i  % D`T [p > i . m| I P"a 3 Vy =p ^  e0e&s` |*9 , nj d sL;X<0_\C vp  C } I`E + nlS ? < y >0   * CD0b   np( w 9 >#P  A,` ef`S 1 zo4 89  e`1e`[ 1&4 - psJ  Jv8ORU A} k "$ |Y]  5@ po 0 { }L U @O0 } Ot0  `P$ P81z6 cT O 66 0G  H | M^ Wm _M L m0 | syK o8u{ -G + 30   Q & +  2}*( r5@&Ce_Ы c `@ vD  2}X 4Q  64&,] Xaco QWT_p >8@J C Qs    I  M0XZ4Rxm pP{  ~p ( V w 8 \ AD&Z5 & af L &(pO  ?  l  8   ; n w yd$x!  ~+ :5@kd|t@  :D0m YD L/9 nFx$G$fa  |؜r  .G  hs<з E   x`  j<; $|; [ f q # y :~ \ |W0  i y=pU 4 VA t >C , $S  XP& < e 12r0  0{ d5` a \%  o , W aPh \ j   8 R3` 6 0D`% o PPl' ~0%L EP? J0S / 0d=  zg > 3M  qf' , 0 24//t  @x$hL T8& h #)  E5y vk ] lR$ip#  l]^G  F3` 3 ~~ xV ! } +0 4 2L ? N M g ` W" 1QSb _Y u%` - (@u  ;vpH % A@ $I zO@ ` ) 4 }D u Rs  !@Ep* &A$Pp z al 4 Q?P  q  s  P<c'p$n P] A  4 n{  W d-`   1 '  Omj F : f bZT  b= Pd&,?0x  <' ~K 4 [ t  t K HxA a d0> F2` 4 S9P }t%  GK ^@k + p4 - d{s4 &# L r _0   ? O `o - ~p`$~ A_v | % i :Zx  G86@  +@0  b  w M :6 *RГ ] QZt~' "X>  -PI` @ !G@  IH G Jp ' / Sp #   M0k  g?PX  1`H  z  NnzV" =q  N  Tp/   p d `0  )\GI} q 1La  V .(S .U| h * @3 $`0?zH  &f % >rP^ C @ti  ; 6  Z  GaШ  uZ" ?ePK T WK - W X O  p>f N d q- @   .?  $Y 9 )> K&P   g] B &Hf  T  92  X g [ "]]  0 0 Ъ  4{7g@ . S &`  VP  By   ,Nl(& )R 3 ^ g  } D # d 'pg r ,1  0   Z`y w Q|p  3v ; Z I  Dhh62P , 1V] 7 > Y R_m  ,Q  NSpM   &l`L I^` H F   m05 y s0 , ?P T tP  t"Т 9 J0gZ nc i D  k > pB`FPIk  4up+tp  1@C 9 9r  8i r 0 EP  Ep` F _!l\  ? 3 H Y`c  p& X  S  U` P WE Q@ u`+VX0Z Ttԛ-z 7p  g@Rg l` 3 1 5 `: %0s  QdN%  HFH&l&  "   dp*e I yi @ "hPT  {pF z B|< {o %Df EP U Z6 o j`>  ;NP  ~c M n$ D R "n` Kf` (r A !X  8x j } d30^  >GL&\t`X 9&pN   H.2`B  :7 r ;  VЂn iP  AJK F pUXva "Kk<<Pj Bܨug Olp g 0Z SG K |p + 0 ' 0@  A\&j y \:  sP  <` G b@e  R182B E h/ p  Z? `qx   4 8S CL% =ln`? ~L>0v @ s I ` dPQ  p" fd$ +$$R$!G@d  b  mH@PT0.  `= ~ I#/  `OP e )L  8x{ ~@/  n8`E Md%]  7(>  fe '  w=   3 ? <x  QMp&d` Y 4 tp [  g x H@ d r@0 T ub # C  ?p yB( u  B kPt 7  J  s( d{ X[0_ =`  9l`Z20  S\ tr ] K @ @_ y k@Z C |dA   c`^ ~e@`t$\%nW O _ ; <)"Azm |^ l n ( } ;=LE w V ! Zh *0Pk |h@  )  In  @0 dp #k0 . $4p 4 z) / `? &d K dP  [0g 6 ? * ]g A @U I K ' \Н y ).FdgW 3 7 ^ A aKPC ou`(Rl Qi'   0 3 M  kr  r: k~p  |p P '<-H :@6 av  @6  j0 4`w? d86Pe r 8.a  k+}":t~Z !4nA6 k 3  .&` #  .   g  oo- + ^f  TX : # 4 |! T08-P  ?nJ   (@J _0Ro  x  j , EP  i@p  0W  70 4 ` + M0 1 y  eY> ~ u  b&PI   *0 9> y I8O  YX x5\4bbp  uvPv z0 - L@b ? IP 6 u hЄ " 5 nt>  ;г   [@=  ` W $e@ / * $ `M  b iP`6 uDFwU lP jq`% ) 0  =>pA ,K ] [0[  qp g y# Y I M+  l- }  R$ pP{1 F3 %P-1   7SU k&5P W K`  .\DE  %|  Y Y\ p 6 -w G ?@P  I Qhp 1 $]Q Rf Q p K#V C 1 s ) w _ pKY <tTp  '  q D V a^ el%@ v 44S[M   ]#@  (+&p  '`  h1`U  OP& 4 _ S0m  $Tp [,p DY[ w m  L2h)@% ;`  X ? tNp K gB ? XLR < qG  H8} * ) } [1 ]X&r 0 * /g  p^0  \D0 q e + m % v= C &*Y  + @  TO$SНk)@F * |/ $ S`%P  /pK B<h   Nk J V  s,|0  hh%D^> j @D } {PS*~{@~. GCQ  g` q So  u J@  GK  I'   o r0+xp, ~&  P@<  V' q v&}  0G 7 ؝U\$'@ 6 _@ -PG , ( 2  I`D GR  \T 5  QU 5 $q  2J n 0lo t p x)@  L [ Le 9 m $08 D[$@ l T  =9@ G   l.  HUЛ  nZH Zz@ O %V   nz l    aR ( L7@E   mSP   V$   9@-  >HQV@| } q jM  s@h   U6W-@% B <1^ 6 %i`C: x0R u "l$(B  1|l1B   u90G HP O M] K&?o W _R #  257p Bo L cI!  g I&xR`{ F cx0P K p   _ C$|#= & $Wp$  #4lP y ( K~ uT J b ; ~ 2 NegtoxU ',P AM8 Vx Jhtx5 z y F40; S _`c qS Cp   O " c  4n`t  fUv. ;  Y`/  x  F\hN&+S  S` }`eT kp f 9:`Y Epw \ ,9p~% MPR + b} T p  a %   EDFp / }o 1 [pv& M 5 a  t; j0 x %6 N _wy l  0 Q)@D  z0 6 WXb BL? <w3P7 5 3h` $ , ( H$ N  |o  A0, #rDA 0 1_ (PF  `e [ 94 d`N ^e|  Is9  r0I   G  h    }H C p2 [ AEi 0 QCp   OP J `  +v  -{$ P @ wo  5 + y'y S > Q PC K `g \ Z 7 z\p 'd S Vs@ @V R    U`) d 3 n  R; =  F^ N .K&Z   , }  N |; a n`: [7o8Z: !l^l  y2 , 9Alibtinfo.so.5__gmon_start___Jv_RegisterClassesUPtgetnumBCtgetstrtgetentPCtputstgetflagtgotolibdl.so.2dlopendlsymdlclosedlerrorlibc.so.6_IO_stdin_usedsetuidstrcasestrsocketfflushstrcpy__printf_chksetgrentpathconf_IO_putcsetlocalembrtowctowlowergai_strerrorstrsignalstrncmpdcngettextgetpwentstrrchrsetservent__longjmp_chkregexecdcgettextwcrtombgetpwuidclosedirstrncpyforksigprocmaskregfreegetgrent__stack_chk_failunlinkselectstrtoldtowuppermemchrstrpbrkgetpidstrftimesbrkiswalnumiswlower__ctype_get_mb_cur_maxstrtolendpwentisattypread64fgetsgetpwnamgetppidwcschriswctype__mbrlensetitimersigemptysetgetaddrinfomemsetstrstr__errno_locationtcsetattrconfstrchdirendgrentmbtowcttynametcflowdup2clearerrunsetenvwctob__fxstat64__fprintf_chksigaddsetiswupperputenv__sigsetjmpstdoutfputcgetrusage__strtoll_internalfputsstrnlenmemcpyfclosetcsetpgrpwcscmp__memmove_chk__vsnprintf_chkstrtoulkillpgstrcatumaskstrcasecmpsetpgidgetpeernamembsinit__strncpy_chkgetgidasprintftzset__lxstat64opendir__xstat64__ctype_b_locregcompwcwidthstderrsigdelsetioctlsetrlimit64group_member__snprintf_chkgetgroupsgetuidreadlinkgetegid__fpurgestrncasecmpsendmsgfilenogethostnamegetcwdfwritegettimeofdaysigactiongeteuid__memcpy_chkwaitpidlocaltimelseek64strchr__vfprintf_chkmblenfdopenreaddir64qsorttcgetattr__ctype_toupper_loc__strcpy_chk__ctype_tolower_locfreeaddrinfosetvbufwcscollfcntlgetrlimit64__sprintf_chkwcsdupgetdtablesizememmovefopen64endserventwcsrtombsbindtextdomainsetgid__strcat_chk__strtoull_internaltcgetpgrp__libc_start_mainsetpwentferrorwcslenstrcollwcsncmpsysconfgetservent__environ_edata__bss_startinitialize_job_controlsys_errormaybe_make_export_envemacs_meta_keymapeval_docdispose_wordsh_double_quote_rl_clear_screenrl_completion_query_items_rl_term_IClast_command_exit_signal_rl_insert_typeintimes_builtinrl_copy_textlast_command_subst_pidifs_firstc_rl_find_completion_wordget_history_eventrl_vi_yank_toprompt_string_pointer_rl_disable_tty_signalsget_job_by_pidlist_minus_o_optsprint_assoc_assignmentmake_select_commandemacs_standard_keymapdisable_priv_moderl_tty_statusrl_tilde_expandsh_ttyerrorbuiltin_dochave_unwind_protects_rl_nsearch_callbackcurrent_host_namesh_canonpathput_command_name_into_envdiscard_unwind_framerunning_under_emacsdequote_stringposix_readline_initializestring_list_dollar_starexecute_command_internalprintf_builtin_rl_init_line_staterl_copy_forward_wordsh_contains_shell_metassh_exitnamed_function_stringit_groupsdircomplete_spellingreader_loopsv_ignoreeoftt_setonecharreadline_internal_charno_argsinput_availparser_remaining_inputupdate_export_env_inplace_rl_erase_entire_lineassoc_referenceprog_completion_enabledsccs_versionassoc_insertextract_array_assignment_listrl_backward_wordprint_commandlocal_builtinprogcomp_sizerl_transpose_charsthe_current_working_directoryansiexpandcoproc_allocarray_dequote_escapes_rl_keyseq_cxt_allocrl_kill_wordindirection_level_stringarray_disposerl_tty_unset_default_bindingsset_signal_handlermake_subshell_commandarith_for_doclast_command_exit_valuesv_histignorerl_completion_modekill_current_pipelinehistory_basedstackbuiltin_warningpolite_directory_formatclose_new_fifosxdupmbstowcsmake_builtin_argvrl_vi_start_insertingbash_add_historyenable_doclogout_doc_rl_input_queued_rl_parsing_conditionalized_outstrlist_to_word_listrl_overwrite_moderemember_argsdispose_cond_node_rl_strip_promptrl_filename_quote_characterswhile_docnew_var_contextset_bash_input_fdsubstringbash_tilde_find_wordglob_char_prl_backward_char_searchlast_shell_builtinhistory_length__libc_csu_finirl_initialize_rl_interrupt_immediatelylist_opttypenumber_of_argsprog_completesarray_dispose_elementrl_forward_charmake_wordset_current_prompt_levelautocdrl_vi_append_modelist_rest_of_argssource_builtinrl_completion_typebuiltin_error_rl_get_screen_sizebind_variable_valuepushd_builtinxpg_echoremove_history_rl_enable_meta_key_rl_convert_meta_chars_to_asciirl_vi_redott_setnocanonget_variable_value_rl_term_imrl_gnu_readline_pfree_buffered_streamrl_funmap_namesshopt_setoptsh_readonly_rl_set_mark_at_posit_signals_rl_savestringshell_execvewlcachesv_histcharscontinue_docpat_subststart_pipelinerl_dispatchingrl_reset_terminalhash_walkjust_one_commandrl_add_funmap_entryrl_directory_rewrite_hookfind_function_rl_complete_mark_directoriescommand_string_indexget_dirstack_from_stringwrite_historyrl_display_promptread_octalrl_vi_tilde_expandrl_set_keyboard_input_timeoutrl_unbind_command_in_mapassoc_patsub_rl_out_streamrl_instreamrl_display_fixedall_visible_variablesrl_forwardreplace_history_entryrl_show_charrl_resize_terminalrl_bind_key_if_unbound_in_maprl_reset_screen_sizesh_getoptrl_messagereplace_history_dataumask_docrl_macro_dumperarray_rshift_rl_vi_initialize_linefind_variable_internalifs_firstc_lensignal_namefind_variableinternal_strmatchrl_abortno_optionsinitialize_trapsparse_and_executesh_notfoundparse_bashoptsend_job_controlunbind_args_rl_init_terminal_ioumask_builtinrl_on_new_line_with_promptfnx_tofshash_stringsh_notbuiltinquote_globbing_charsdist_versionexecutingsubshell_argvttsetattrsource_searches_cwdrl_noninc_reverse_searchget_current_user_inforl_execute_next_rl_copy_undo_entryrl_macro_bind_rl_control_keypadxfreerl_get_keymap_namecommand_connect_rl_kscxtit_shoptsselect_doc_rl_free_saved_history_line_rl_term_forward_charpopd_builtinrl_byte_orientedshow_name_attributeshistory_write_timestampsbreak_docbash_readline_initialized_rl_horizontal_scroll_modewith_input_from_stdinttfd_eightbitenable_history_listmake_word_from_tokenno_invisible_varscheck_hashed_filenamesrl_variable_valuehistory_expansion_charmaybe_execute_filehist_last_line_addedsave_parser_stateuitoschange_flagtrue_doccurrent_readline_line_indexdescribe_pidtop_level_maskrl_on_new_line_rl_adjust_pointit_keywordscopy_fifo_listmaybe_append_historyall_exported_variablesset_shelloptsthe_printed_commandsignal_namesreset_completer_word_break_charsdelete_job_rl_term_eimaybe_set_sigchld_trapunquoted_glob_pattern_ppush_streamexecuting_builtin_fp_hwrl_bind_key_in_maplast_asynchronous_pidrl_basic_word_break_characterssuspend_docfind_shell_builtinarray_patsubrl_pending_input_rl_page_completionsbuiltin_address_internalinitialize_terminating_signals_rl_possible_control_prefixes_rl_eof_char_rl_suppress_redisplaygive_terminal_torl_unbind_function_in_maprl_copy_keymapcoproc_listrl_reverse_search_historyalias_expand_allrl_filename_dequoting_functionparse_and_execute_levelhave_devfdexecute_commandrl_doneshould_ignore_glob_matchesstrlist_prefix_suffixtime_to_check_mailset_buffered_streamrl_restore_staterl_inhibit_completionhistory_expansion_inhibitedbind_assoc_variablepipeline_pgrprl_key_sequence_length_rl_set_insert_moderemember_on_historyrl_ignore_completion_duplicatesstrsubpwd_docenable_hostname_completiontt_setcbreakpop_contextlet_builtindispose_variablettattr_rl_output_some_charscommand_word_completion_functionsh_regmatchall_array_variablesbash_brace_completionread_historymake_cond_noderl_completion_append_charactereof_encountered_limitposix_initialize_rl_keyseq_chain_disposerl_yankmax_input_historyinitialize_bash_inputpop_var_contextrl_universal_argument_rl_top_levelcheck_identifiersh_single_quotelist_running_jobszsyncfdhistory_quotes_inhibit_expansionstrlist_from_word_listtermsig_sighandlerassigning_in_environmentbash_default_completionbinary_testps2_prompthistory_getuinttostrcurrent_usercurrent_command_line_count_rl_arg_overflowrl_yank_popreturn_catch_flag_rl_enable_keypadinitialize_aliasesrl_possible_completionsrl_binding_keymapexit_builtinrl_restore_promptsuspend_builtinrl_ignore_some_completions_functionrl_generic_bindrl_filename_quoting_desiredtt_seteightbitrl_set_keymaprl_vi_change_charbuild_versionreadline_internal_setuprl_getc_functionget_array_valueword_splitfile_statusset_sigchld_handlerrl_visible_prompt_lengthhistory_lines_this_session_rl_term_clreolit_arrayvarstilde_initializeexec_docclose_buffered_fdall_variables_matching_prefixrl_rubout_or_delete_rl_last_v_posrl_translate_keyseqcurrent_readline_prompt_rl_isearch_dispatchit_serviceserror_trace_modefind_reserved_wordsh_set_lines_and_columnsxtrace_print_for_command_headduplicate_buffered_streamget_shopt_options_rl_push_executing_macrohistory_builtinzreadcrl_vi_searchvariable_context_rl_enable_metauser_command_matchesstrvec_dispose_rl_dispatch_subseqhistory_lines_in_filerl_executing_macrorl_backward_char_rl_input_availablettfd_onechararray_dequotehashing_enabledulimit_doccurrent_command_subst_pidrl_deprep_term_functionarray_removerl_dump_variablescompgen_builtin_rl_char_valuetrap_to_sighandler_rl_tracerl_character_lentype_builtinset_pipestatus_arraystrlist_disposeit_jobsrl_rubouterr_badarraysubrl_add_defunset_locale_varadd_history_timepcomp_curcssh_optoptreturn_builtinsv_strict_posixpop_scope_rl_doing_an_undorl_catch_sigwinchhistory_inhibit_expansion_functioncdspellingreturn_catchstrvec_copysave_token_stategetmaxchildmake_word_listrl_editing_moderl_forward_search_historymake_simple_commandcommand_errstrhistory_is_stifledget_directory_stack_rl_vi_reset_lastsource_docrl_beg_of_linerl_complete_rl_backspacettfd_noechopopd_docrl_redisplaylast_history_lineunset_builtinrl_clear_pending_inputbash_servicename_completion_function_rl_insert_charcompgen_docgetmaxgroupsttnocanonrl_get_keymap_by_namestream_on_stackexpand_arith_stringrl_kill_regionsh_mktmpfdunbound_vars_is_errordisown_docprogcomp_removebind_var_to_intexport_builtinbind_builtinassoc_quotenoclobberset_tty_stateexpand_prompt_stringremove_aliashist_last_line_pushedparse_shelloptsinitialize_shell_builtins_rl_clear_to_eolcommand_execution_stringmaybe_add_historyset_bashoptsindirection_levelrl_copy_backward_wordother_token_alistsh_statcmd_initset_signal_ignoredcurrent_command_numberabsolute_pathnamestring_list_internalrl_arg_signstrvec_sortprint_func_listcoproc_fdsavereset_signal_handlers_rl_terminal_can_insert_rl_term_ipwant_pending_commandhistory_searchsh_invalidoptrl_vi_insert_modewait_signal_receivedrestore_default_signalset_job_controlunbind_array_elementarray_createset_error_trapsh_closepiperl_bind_keyseq_in_mapunlink_fifoshift_builtinno_symbolic_linksbuiltin_usagereadonly_builtinrl_clear_signalstilde_expansion_preexpansion_hookkill_doc_rl_susp_charfg_percent_docsh_mktmpnamedispose_fd_bitmaprl_insert_commentrl_newlinedo_word_assignment_rl_internal_char_cleanuprl_filename_rewrite_hooksh_modcaseget_minus_o_optsset_dollar_vars_unchanged_rl_term_pcdefault_tty_job_signalsrl_readline_statearray_inserthistory_subst_charrl_completer_word_break_charactersunset_docrl_freesv_histtimefmtunwind_protect_memwdcachecleanup_the_pipelinesh_invalidsigwait_builtinexec_builtindirs_builtinparse_string_to_word_list_rl_enable_paren_matchingcopy_function_def_contentspop_dollar_vars_rl_dispatchsourcelevelget_current_prompt_levelfind_string_in_alistdescribe_commandtrap_docmake_word_flags_rl_rubout_charphash_searchrl_vi_subst_rl_complete_mark_symlink_dirsbash_input_fd_changedbashline_reset_rl_set_the_linetest_docalloc_word_descrl_insert_moderl_directory_completion_hooksv_opterrstupidly_hack_special_variables_rl_search_getcharsetifsstream_listset_itemlist_dirtyfatal_errorsubshell_argcpre_process_lineshell_eof_tokenprint_arith_commandrl_completion_matchesrl_tab_insert_rl_revert_all_at_newlinestring_rest_of_argsprint_var_functionloop_levelextract_arithmetic_substlocaletransarray_to_stringrl_modifyinghistory_tokenize_rl_redisplay_after_sigwinchfind_flag_rl_make_prompt_for_searchfg_builtindispose_exec_redirectsreturn_doc_rl_get_char_lenlocal_exported_variables_rl_tropenunset_bash_input_rl_abort_internalrl_copy_region_to_kill_rl_move_vert_rl_meta_flagmake_case_commandrl_undo_listprintf_docconditional_docremove_quoted_escapes_rl_reset_argumentrl_make_bare_keymapinitialize_shell_optionsfail_glob_expansionget_working_directoryrl_get_next_historyfind_tempenv_variablemake_function_def_rl_term_dccommand_builtinsh_unset_nodelay_modestatic_shell_builtinsset_var_read_onlyrl_completion_mark_symlink_dirscolon_doccd_docrl_invoking_keyseqsfunction_dochistory_get_timettcbreaktime_doczwrite_getenvstdin_redirget_exitstatcoproc_closerl_read_init_filevi_insertion_keymapbuiltin_builtinrl_filename_completion_desiredbuiltin_addresshistory_expansion_rl_term_gotorestore_original_signalsmaybe_save_shell_historyexecuting_listunset_sigwinch_handler_rl_in_stream_rl_echoing_prl_completion_display_matches_hookreset_shell_flagsrl_end_undo_groupbegin_unwind_framedisown_builtinrl_crlfset_debug_trap_rl_copy_undo_listassoc_quote_escapesrun_return_trapdeclare_doc_rl_restore_tty_signalscheck_binary_filedispose_saved_dollar_varssh_invalidoptname_rl_screencharsrl_named_functionlist_all_jobsrl_bind_key_if_unboundrl_unix_word_ruboutalias_expandmake_local_variabledisallow_filename_globbingalready_making_childrenreset_internal_getoptrl_vi_prev_wordexpand_string_unsplitcoproc_fdrestoreifs_var_rl_keymapde_backslashrestore_pgrp_pipebash_directory_completion_matchesrl_executing_keymaprl_complete_with_tilde_expansionsame_file__data_startcurrent_command_first_line_savedassoc_removebash_history_disablewhich_set_flagsrl_display_match_listrl_delete_horizontal_spacerl_unbind_key_in_map_rl_move_cursor_relativeget_group_listbash_initialize_historysh_mktmpfpglob_ignore_caseall_shell_variableslist_one_jobxtrace_fdchkrl_replace_from_historysh_invalididrl_vi_putrl_backward_kill_linerl_free_undo_listzreadintrhistory_delimiting_charswithout_job_controlrl_arrow_keysmake_command_stringtype_docmap_overset_default_langdispose_used_env_varslcurrentfifos_pendingsave_input_line_state_rl_callback_data_disposemake_if_commandwait_forvariable_help_docthis_command_namesource_fileignore_tty_job_signalsclean_itemlistsubshell_envpsv_histsizehistory_doc_rl_free_history_entryclose_fd_bitmapbash_getcwd_errstrpush_dollar_varsshow_all_var_attributeserr_readonlyrl_free_line_stateset_working_directorysubshell_environmentrl_outstreamprint_simple_commandsv_comp_wordbreaksphash_insertrl_save_promptrl_dump_macrosmake_variable_valueread_from_stdininitialize_signalsuntil_doccoproc_rclosezreadcintrit_functionsxtrace_fptilde_expand_wordlegal_alias_namembschrfunmap_program_specific_entry_startexpand_words_shellexpsh_neednumargcoproc_pidchktilde_additional_prefixescommand_substituteadd_aliasget_word_from_stringget_hostname_listyycharasynchronous_notificationrl_completion_found_quoteinit_mail_datesifs_cmapcase_docxtrace_setassign_array_from_stringrl_pre_input_hookshopt_builtindirs_docgetifs_rl_trclose_rl_char_search_internalstrlist_resizerl_vi_back_to_indentrl_vi_check_rl_completion_prefix_display_lengthexecutable_filejsmalloc_trace_at_exitinitialize_flagsstrvec_from_word_list_rl_errmsgstdin_redirectsmake_coproc_commandbind_keyseq_to_unix_commandsh_backslash_quote_rl_revert_all_linesposixly_correctset_login_shellterminate_stopped_jobsbash_badsub_errmsgarray_unshift_elementrl_vi_delete_rl_vi_textmod_commandrl_vi_bWordrl_reset_line_staterl_variable_dumperit_builtinshist_verifyget_name_for_errorprivileged_modeassoc_modcaseno_line_editinghistory_comment_charrl_already_promptedsplit_at_delims_rl_arg_callbacksh_restrictedinterrupt_statebash_licensethe_current_maintainergetcoprocbypidrl_tty_set_default_bindingssh_setlinebufrl_unix_line_discardrl_vi_fWordrl_make_keymap_rl_fix_point_rl_with_macro_inputsh_backslash_quote_for_double_quotesvalid_array_referencesh_makepath_rl_find_prev_mbcharexpand_words_no_varsrl_completion_entry_functionrl_vi_insert_begfmtulongpcomp_set_compspec_options_rl_caught_signalpipefail_optcompopt_doc_rl_block_sigintzmapfdfuncnest_maxmailstathistory_search_delimiter_charshistory_search_posmap_over_funcsrl_vi_char_searchsh_nojobsttrestoreprint_cond_commandrltty_set_default_bindingsassign_array_var_from_word_listrl_begin_undo_grouprl_initialize_funmaprl_library_version_rl_quit_char_rl_unget_char_rl_pop_executing_macrointernal_wstrmatchget_job_by_name_rl_comment_beginkill_all_local_variablesit_setoptsexecute_variable_commandrl_get_keymap_name_from_edit_moderl_insert_textrl_attempted_completion_functionhash_builtinarray_keys_rl_want_redisplayset_default_localeit_filesmark_modified_varsread_builtinrun_debug_trapget_random_numberwordexp_only_rl_complete_show_allreset_parsersigint_sighandlernum_shell_builtinsgen_compspec_completionsset_return_traprl_get_termcapmk_msgstr_rl_init_eightbit_rl_term_backspacehistory_expand_rl_callback_dataexecuting_line_numberexpand_string_to_stringunstifle_history_rl_find_next_mbcharrl_event_hookpcomp_curcmdexit_shellinit_yy_ioclear_hostname_listlist_optarg_rl_output_meta_charshash_copyarray_create_elementglob_vectorparse_stringexpand_word_unsplitshell_is_restrictedrl_vi_overstrike_deleterl_digit_argumentrl_vi_overstrikerl_capitalize_worddirspellrl_bind_keyseqsave_pipelinestrlist_createrl_vi_set_markassoc_to_word_listinternal_warningshell_compatibility_levelrl_redisplay_functioncoproc_initfc_execute_fileyy_input_name_rl_scxt_disposechar_is_quotedfind_index_in_alistsignal_is_specialwith_input_from_stringrl_noninc_forward_searchrl_yank_nth_arg_rl_dispatching_keymaprl_stop_outputforce_append_history_rl_dispatch_callbackprotected_mode_rl_to_lowerbash_logoutclear_unwind_protect_listrl_vi_delete_tosecondary_promptsh_optargrl_history_search_backwardis_directorymove_to_high_fdrl_num_chars_to_readrl_transpose_wordssh_un_double_quoterl_char_is_quoted_pmake_arith_for_commandbash_history_enablerl_terminal_namefind_user_commandlist_lengthglobal_error_listsh_erangezcatfdcaller_dochistory_set_history_stateunbind_variable_rl_pushed_input_availablerl_callback_read_charsignal_is_trappedenable_builtinrl_revert_linerelease_statusrl_start_kbd_macro_rl_overwrite_rubout_rl_strindextrap_builtinhelp_builtindispose_var_contextshopt_listoptset_impossible_sigchld_trapsh_needargansicstr_rl_release_sigintdispose_function_defarray_to_argv_rl_callback_funcsv_localesubshell_top_levelshell_namexstrmatch_rl_vis_botlinstrlist_appendfc_docttfd_cbreakrl_get_keymaprestricted_shelldont_save_function_defs_rl_set_cursorstrcreplaceclose_pgrp_pipehistory_no_expand_charsrl_set_signalscompletions_to_stringlist_rl_output_character_functionrl_delete_textshow_shell_versionevalexp__libc_csu_initungetc_with_restart_rl_argcxtttnoechodeclare_builtin_rl_term_uprl_attempted_completion_overrl_deletepush_contextrl_replace_linesh_badjobzreadretryrl_upcase_wordrl_completion_word_break_hookstrip_trailing_ifs_whitespacerl_markarray_variable_name_rl_term_icrl_backward_byte_rl_last_command_was_killdispose_word_descclean_simple_commandrl_re_read_init_filerl_vi_goto_markcd_builtin_rl_isearch_callbackrestore_input_line_statemake_redirectionrl_forced_update_displaycheck_window_sizeprogramming_errorrl_noninc_reverse_search_againxmbsrtowcsarray_expand_index_rl_arg_getchar_rl_completion_case_foldrl_vi_change_case_rl_null_functioncommand_errorloptendreadarray_docxtrace_resetzgetlinextrace_initarith_docpcomp_set_readline_variablesshell_version_string_rl_reset_completion_stateexpanding_redircoproc_flushreturn_EOFsync_buffered_streamrl_linefunclogout_builtin_rl_term_autowrap_rl_allow_pathname_alphabetic_charstrap_saved_exit_value_rl_isearch_terminatorsset_ppidstartup_statestrlist_mergebash_clear_historyexpand_compound_array_assignmentrl_vi_fetch_historyit_disabledhistory_get_history_statearray_remove_quoted_nullsprogcomp_flushecho_command_at_execute_rl_pure_alphabeticforce_fignorewait_docrl_exchange_point_and_markshell_start_timebind_functionparser_errorbash_groupname_completion_functioncurrent_prompt_stringgetopts_resetrl_vi_domoveremember_mail_datesmake_new_assoc_variableexpand_wordsfsleepassoc_to_stringparse_symbolic_modedecode_prompt_stringrl_set_markwait_for_background_pidsstrvec_resizeif_docextended_globassign_array_var_from_stringdisplay_signal_listfree_pushed_string_inputcoproc_reapvi_movement_keymapdo_redirectionssh_coprocstart_jobget_new_window_sizecontinuingaddtimevalmatch_ignore_caserunning_trapansic_shouldquotefalarmextract_process_substrl_dingfalse_docset_pwd_rl_callback_data_allocrl_vi_columnneed_here_docabsolute_programhistory_reeditingcoproc_docrl_refresh_line_rl_is_mbchar_matchedrl_last_funcstrvec_removebreakingxtrace_print_assignmentbind_array_variableexpand_string_assignmentxtrace_fdjump_to_top_levelrl_complete_internalstrlist_copyignore_signalfind_aliasdelete_all_aliasessh_syntabsizttgetattrunlink_fifo_liststrvec_lengetopts_docpop_streammake_group_command_rl_digit_pskipsubscriptgetcoprocbynamerl_set_prompthash_sizerl_backward_menu_completerl_vi_first_printredirection_expandlegal_identifierfile_errorlist_optoptgrouping_braces_docplace_keywords_in_env_rl_erase_at_end_of_linearray_keys_to_word_listbind_int_variableoptflagsreset_mail_filesfnx_fromfsskip_to_delimcaller_builtincommand_oriented_historysh_validfdrl_discard_keymap_rl_echoctlsv_history_controlsigwinch_receivedsh_physpathwait_intr_bufmaybe_make_restrictedrl_unbind_key_rl_digit_valuerl_vi_ewordadd_unwind_protecthash_disposesv_xtracefdrl_invoking_keyseqs_in_maprl_line_buffer_lencolon_builtin_rl_history_preserve_pointunbind_funcsh_realpathrl_vi_replacerl_reset_after_signalget_tty_statecheck_jobs_at_exitmake_until_commandcopy_function_def_rl_iscxtrl_filename_completion_functiondo_assignmentrl_alphabeticrl_vi_insertion_moderl_catch_signalsrl_kill_textrl_visible_statscopy_history_entry_rl_scxt_allocrl_forward_wordremove_backslasheshistory_arg_extractget_locale_varrun_unwind_protectsrl_basic_quote_characterssetup_async_signalscurrent_readline_linesearch_for_commandrl_add_undo_rl_fix_last_undo_of_typeunfreeze_jobs_listsignal_in_progresstest_commandrl_special_prefixesrl_vi_bwordphash_flushdispose_redirectsrl_vi_eof_maybettonecharcheck_bash_inputsh_get_home_diremacs_ctlx_keymap_rl_vi_last_commandsetup_ignore_patternsrl_forward_bytesh_badpidfull_pathnametteightbitforced_interactiverl_completion_suppress_quotetimes_docarray_modcaserl_backwardarray_assign_listset_minus_o_optionall_digitsdebugging_login_shellrl_get_previous_historyrl_getcassoc_disposerl_variable_bindget_numeric_argbash_delete_histenteof_encounteredshift_docifs_valuemake_commandrl_deprep_terminalreset_mail_timerrl_completion_suppress_appendhup_on_exityyerrormake_bare_simple_commandfg_docrl_promptrl_filename_quoting_functionforce_execute_filefilter_stringlistrl_kill_full_linesh_getopt_restore_statedelete_all_jobssigwinch_sighandler_rl_compare_charssv_optindrl_vi_fwordrl_point_rl_any_typeinecho_builtinread_commandsh_invalidnummake_here_documentset_langrl_readline_versionrl_function_of_keyseqcurrent_fds_to_closearray_quotequote_string_for_globbinggnu_error_formatclose_buffered_streamlocal_docinteractive_shellulimit_builtintypeset_doccoproc_fdchkexpand_assignment_string_to_string_rl_mark_modified_linesset_dirstack_elementwait_for_single_pidrl_endbash_dequote_textset_or_show_attributesrl_beginning_of_historystrlist_flush_rl_saved_line_for_historydecode_signal_rl_free_match_listrl_parse_and_bindphash_remove_rl_block_sigwinchrl_menu_completeunalias_builtin_rl_intr_charbrace_expandfind_path_filebase_pathnameansic_quotemake_local_array_variableprint_timevalhistory_search_prefixnohup_all_jobsrl_expand_promptthrow_to_top_levelcompspec_copyconnect_async_listttsave_rl_last_c_posassoc_subrangecopy_redirectall_visible_functionslist_stringcopy_commandpushd_dockill_pidnew_fd_bitmapterminating_signalrl_vi_movement_modeadjust_shell_levelsh_badoptdequote_listsh_mkdoublequotedfind_special_builtindispose_function_def_contentsrl_prep_terminalparse_and_execute_cleanupparse_command_rl_set_screen_sizerun_pending_trapsfile_iswdir_rl_current_display_linebg_builtinbash_delete_last_historysh_get_env_valueifs_firstchar_rl_vi_set_lasttrap_listrl_insert_closestrlist_printrl_menu_completion_entry_function_rl_release_sigwinchrl_clear_messagefc_builtinxtrace_print_select_command_headcurrent_tokentimeval_to_secsfalse_builtinrl_vi_next_word_rl_bell_preference_rl_signal_handlerarray_shift_elementcontinue_builtinarray_shiftfind_or_make_array_variablerl_discard_argumentrun_interrupt_trapget_group_arrayprint_shift_errorgetopts_builtinbuffered_ungetchartempenv_assign_errorshow_var_attributesxtrace_print_cond_termprint_var_valuesh_wrerrorsh_syntaxtabcurrent_builtinfmtumaxit_commandsrl_blink_matching_parenrl_set_paren_blink_timeoutrl_vi_undomake_local_assoc_variablerestore_parser_staterl_quoted_insertwhere_historyrl_startup_hook_rl_arg_init_rl_vi_done_insertingcdable_varsglobal_commandrl_sort_completion_matchesextract_colon_unitwcsmatch_rl_nscxtmaybe_call_trap_handleropen_buffered_streampatch_levelSBsv_pathit_aliases_rl_to_uppercheck_dev_ttystrip_trailingbrace_expansion_rl_update_finalit_directoriesread_docprogcomp_createglob_error_return_rl_term_crdispose_wordsrl_prefer_env_winsizedefault_buffered_inputcond_expand_wordassoc_keys_to_word_listit_hostnamesrl_cleanup_after_signalfind_token_in_alistrl_char_searchprogcomp_searchrl_set_keymap_from_edit_modefile_existsrl_completion_invoking_keysv_tzcommand_docrl_maybe_replace_linereset_shell_optionsit_exportsdollar_dollar_pidrl_inserthash_doclast_made_pidcompopt_builtinmapfile_builtinunclosed_pairset_dollar_vars_changedmakunboundterminate_immediatelyrun_unwind_framesubshell_level_rl_next_macro_keyhangup_all_jobsthis_shell_builtinconvert_var_to_arraymake_new_array_variableit_usersbuffered_getcharprogcomp_disposereadonly_docrl_noninc_forward_search_againsh_chkwriterl_echo_signal_charxtrace_print_case_command_head_rl_lowercase_ptest_bracket_docpromptvarsinitialize_itemlistjobs_docnetopenminus_o_option_valuedump_po_stringsnotify_and_cleanuprl_kill_linerl_vi_matchcurrent_historyset_default_locale_vars_rl_possible_meta_prefixescompspec_createcomplete_builtin_rl_arg_dispatchrun_exit_trapshell_ttystrvec_to_word_listrl_insert_completionsstrlist_walkcoproc_unsetvarsrl_backward_kill_wordextract_command_substperform_hostname_completionrl_vi_end_wordbashline_reinitializepop_argsexec_redirection_undo_listnohup_jobsignal_is_ignoredarray_quote_escapessh_optindassign_compound_array_listwith_input_from_streamrestore_token_staterl_push_macro_inputrl_readline_namerl_bind_keyseq_if_unbounddispose_commandmbstrlen_rl_echo_control_charsxmallocsave_bash_inputtest_binop_rl_read_mbchararray_variable_partrl_undo_command_rl_screenwidthall_shell_functionsexpand_aliasesecho_docexport_docps1_promptcoproc_setvarsprogcomp_insertfd_is_bash_inputhistory_word_delimitersreset_shopt_optionshistory_max_entries_rl_start_using_historysh_opterrrestart_job_controlsort_variablesmail_warningcoproc_checkfdcompspec_disposetest_builtinpush_var_contextstrlist_removerl_callback_handler_installspnamearray_flushrl_emacs_editing_moderl_maybe_unsave_lineword_token_alistfree_mail_fileshistory_total_bytespush_argsxtrace_print_word_listterminate_current_pipeline_rl_ttymsgunary_testlist_reversearray_to_word_listmake_while_commandprimary_promptglob_starallow_null_glob_expansioncheck_add_historyyylvalrl_explicit_argrestore_pipelinerl_read_keystop_making_childrentilde_expansion_failure_hookdump_translatable_stringslet_docmake_arith_commandbreak_builtinhistory_numberphash_createdo_assignment_no_expandrl_maybe_save_lineadd_or_supercede_exported_varunalias_docsetup_glob_ignorerun_sigchld_trapmake_absoluterl_list_funmap_namesvar_lookupshell_initializedassoc_dequoterl_completer_quote_charactersEOF_Reachedtop_level_cleanupglobal_variablesword_list_remove_quoted_nullsuconvertrl_free_keymapprint_rlimtypemapfile_docarray_copyrl_vi_yank_argrl_end_of_historyrl_callback_handler_removerl_extend_line_bufferrl_set_retained_kills_rl_match_hidden_filesset_pipestatus_from_exitinternal_errorrl_vi_append_eolstring_list_dollar_atassoc_dequote_escapes_rl_kill_kbd_macroreinit_special_variablescopy_wordttfd_nocanonrun_trap_cleanupdebugging_moderl_vi_eWordremove_unwind_protectassoc_remove_quoted_nullszreadbash_re_edit_rl_undo_group_levelyynerrsprint_var_listeval_builtinxparse_dolparenarray_from_word_listexit_docexit_immediately_on_errorarray_sliceget_alias_valuett_setnoechorl_completion_quote_characterjobs_builtinreturn_catch_valuebg_docset_signalerr_unboundvarreport_errorread_but_dont_executesv_ifsdelete_all_contextsecho_input_at_readstring_to_rlimtypeassoc_to_assigndot_found_in_searchyyparsemake_for_commandrl_unix_filename_ruboutrl_downcase_wordit_bindingsno_empty_command_completionrl_stuff_charset_var_attributebgpidsset_sigint_handlerprogrammable_completionsalloc_history_entryshell_glob_filenamerl_do_undothis_shell_functionarray_needs_makingsh_eaccesscomplete_docnoglob_dot_filenameswait_for_job_rl_term_DC_rl_bind_stty_chars_rl_qsort_string_comparestring_quote_removaldifftimevalfind_function_defhostname_list_initializedassoc_flushsource_uses_pathget_dollar_var_valuerl_vi_change_toarray_to_assignrun_error_trapit_enabledhash_bucketrl_erase_empty_linesv_globignoreexecutable_or_directoryzreset_rl_read_mbstring_rl_screenheighttrim_pathnamerl_do_lowercase_versionget_job_specrl_dump_functionsmake_funcname_visiblekill_builtinrl_vi_arg_digitxreallocexpand_word_leave_quotedsubst_assign_varlist_rl_overwrite_char_rl_term_clrpagrl_set_keyhistory_truncate_file_rl_skip_completed_textrl_vi_bracktypereset_terminating_signalsjobs_m_flagexpand_stringrl_call_last_kbd_macrohistory_set_posprint_array_assignmentmake_bare_wordrl_function_dumpersv_terminaloriginal_pgrpisnetconndot_docinitialize_shell_variablessh_openpipe_rl_clean_up_for_exitreap_dead_jobsalias_expand_word_rl_complete_show_unmodifiedxtrace_print_arith_cmd_rl_uppercase_p_rl_keyseq_cxt_disposenum_fifosget_string_valuearray_walkrl_history_search_forwardthe_printed_command_sizepush_scoperl_skip_csi_sequenceexecute_shell_functionwith_input_from_buffered_streamrl_prep_term_functionmake_pattern_listcoproc_wclosethe_printed_command_except_trapcoproc_fdcloseredirection_errorrl_delete_or_show_completionsrl_yank_last_argit_stoppedconvert_var_to_assocset_if_notrl_username_completion_functionlist_stopped_jobs_rl_replace_text_rl_walphabeticno_exit_on_failed_execgather_here_documentsbash_history_reinitcoproc_closeallsv_hostfiletimeval_to_cpumerge_temporary_envcomsub_ignore_returnsub_append_stringrl_bind_keyseq_if_unbound_in_mapinteractive_commentsrpm_requiresstrlist_sortmake_default_mailpathstring_list_pos_paramsrl_save_state_rl_add_macro_charfunction_trace_modeit_variablesload_historyassign_array_elementtilde_additional_suffixestermsig_handlerpwd_builtinit_runningextended_quote_rl_history_saved_pointsetup_history_ignorecopy_word_listcoproc_disposepushed_string_listmake_cond_commandtest_unopinit_job_statslocaleexpandstrvec_flushrl_vi_search_againbash_tilde_expandreadline_internal_teardownbind_docshopt_docrl_line_bufferrl_restart_outputrl_numeric_argcount_all_jobsrl_end_kbd_macrolegal_numberread_history_rangeinitialize_bashoptsarray_subrangerl_vi_editing_modeinitialize_readlineinitialize_job_signalsrl_vi_ruboutbash_copyrightmake_childunbind_function_defrl_end_of_linerl_bind_keyliteral_historyrl_old_menu_completeread_secondary_linesv_mailhistory_offsetstrvec_createshell_function_defscopy_redirectsxbcopydelete_all_variablesrl_untranslate_keyseqexpand_string_unsplit_to_stringstop_pipelinesave_pgrp_pipefd_to_buffered_stream_rl_print_completions_horizontallyrl_vi_completeprogcomp_walkterminal_pgrpassign_in_envfile_isdirshell_pgrpstrvec_strcmpGLIBC_2.1GLIBC_2.0GLIBC_2.4GLIBC_2.3GLIBC_2.11GLIBC_2.3.4GLIBC_2.2   h0ii ii ii ii ƀЀti ۀii ii ii H vp   $ ( , 0 48<@DHLPTX\`dhlptx |!"#$%&'()*+,-./012Ē3Ȓ4̒5В6Ԓ7ؒ8ܒ9:;<=>?@ABCD EFGHI J$K(L,M0N4O8P<Q@RDSHTLUPVTWXX\Y`Zd[h\l]p^t_x`|abcdeffghijklmnopqērȓs̓tГuԓvؓwܓxyz{|}}~  $(,048<@DHLPTX\`dhlptx|ĔȔ̔ДԔؔܔ US[X t ԒX[5%%h%h%h% h%h %h(%h0%h8p% h@`%$hHP%(hP@%,hX0%0h` %4hh%8hp%<hx%@h%Dh%Hh%Lh%Ph%Th%Xh%\hp%`h`%dhP%hh@%lh0%ph %th%xh%|h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%Ēh%Ȓh%̒h%Вh%Ԓh%ؒh%ܒhp%h`%hP%h@%h0%h %h%h%h%h%h%h% h%h %h(%h0%h8p% h@`%$hHP%(hP@%,hX0%0h` %4hh%8hp%<hx%@h%Dh%Hh%Lh%Ph%Th%Xh%\hp%`h`%dhP%hh@%lh0%ph %th%xh%|h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%ēh%ȓh%̓h%Гh%ԓh%ؓh%ܓhp%h`%hP%h@%h0%h %h%h%h%h%h%h% h%h %h(%h0%h8p% h@`%$hHP%(hP@%,hX0%0h` %4hh%8hp%<hx%@h%Dh%Hh%Lh%Ph%Th%Xh%\hp%`h`%dhP%hh@%lh0%ph %th%xh%|h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%Ĕh%Ȕh%̔h%Дh%Ԕh%ؔh%ܔhp%h`%hP%h@%h0%h %h%h%h%h%h%h% h%h %h(%h01^PTRh gh0gQVhOUSd$=u> 9st& 9rd$[]Ív'Ud$tt $ÐUd$4]ut ]u]á$$04$$$t$H4st>uW$/bin@/sh8[$N$c$\$<]u]Tt&4$$-$t$롍&D$D$g$$ã4$$\$v4$/bin@/sh8$f/<F&Ud$Uu2H~&$rHÐHyt&Ud$D$$O Ud$$$\,$$(,0É'Ud$ dɉu}t u}]fE$ƀ-t#1ruؿgu}]ÍvՐ&UWVd$E$1Ҁ8-‹5dЅu 8rt d$1^_]Ðgu$l$`$hT$hHdd$^_]ÐUd$E$&'USd$]$$$Xucvu uD$ t utK$v$t10ۍ&&뭐&c댍& 1뮉'Ud$$T$0 HÍ'UWVSÍd$҉U5@D$D$ j$7D$t$t$ D$${D$D$-tD$]4$tD$D$fh$}D$t$ D$$<$Mtt5@D$D$j$4D$t$ D$$|5@D$D$j$D$t$ D$$Bd$L[^_]ÐD$D$ h$D$D$&ht$ D$$7US$ eE1V$v  ludD$$$|0w& lu dtV$ludu1=t$3Ee3$$[]Ð1=tf1=tN&{$sX$fXD$$xT R!%tDJD)ڃ$$\${vyhiUSd$t8ud$[]D$$Ht8u$%d$[]ÍD$$ٍUSd$D$E$#tL6o~d$$[]fD$ \$D$$hE$$U$T$j$D$D$hd$$[]Ívd$$[]fd$$[]Ív'UWVS$<$eE1.$C$|$D$$5`$<$$$|$`$hގt @hDž$$h躎t @<1$h螎tj@td@t$ D$<$' tQX‰$T$VljD$ D$$<$t$D$<$̦$D$h$D$讦$$D$D$ãHD$D$$ t$$D$n$1$H4$"Ue3$[^_]Ít&D$ D$D$$!ЃtVD$P}$|$BtD$<$ D$ D$D$$c$D$D$ãHD$D$$=X0 x@$fS8tT4$1~$D$D$0k$$t$$~v4$zu<$vt=4$^D$ $ËxjtQD$89E6M t :-. D$H@\$H9] E $\$1ҡcD8B1;,-Bx.3$]$8-n@@t$ۉ=Ht;et"1ҍ<=4D$D$Hi$*u…tD$Ii4$buD$=i$K@@X@$D$D$$h赟$hi|_<:<= u=h$u.~= =00$ áT1҅u|= uV=lt =uDu5=hu,=lu#pPpu$h{=0w=tu|==hQ=|uLD$$$1ۡT14=|uO1ۃ==huу=t$Viy0= = 1`D$H$uU$H=1H$贺4D$D$k$$D$h3~;dD$Ci$Z=H1;et*1t&D$D$=i$uR1-T$(D$$/T$(sD$D$i$T$(t$T$$6]D$D$k$$\$=lpPp$h赠LD$$$aiUw$$hMD$$mi=hu8D$$iD$$i~D$$zibD$HM >D$HD$H`D$$mi*=hu?D$$i tTD$$iuD$$ziÐUd$D$D$m$D$$$ {$g Ud$ZG t2=t)$m軞tD$m$=t.xuÍvEEÍv$dt#D$ D$mD$$O$Hi Ud$$u]}51E1uhuWۉt-t#~$pE$D$b]u}]Íf뢐$c뉐$n$t`@tUD$ D$$XE6D$$SbE<$vE1'USd$̡<EE<& u<t _&EEtcE@8$@EtE$E@D$$#XQ t@E<>D$ \$D$$n_8tAE@;t&--<d$4[]Ðt&$$4)D$o $(`v(0Et j$`]cSfu  t E뜐EE$"E$U]Í*nUD]ÍUSEt t ZD[]Ðt&U҉u ]Ít&tR]ÍvUJ EB]ÍUUu&t9Pu]Í1]ÍUEt"PP@ ]fUu1]Ëx;}]É'U=t&~,=~e=(=&&]Ð)[(} t&tftލ1=u1=]Ð=}= |=~=uf}#{};u뇍&=.utt&w`yKt&'U҉Sueu_ )t` 1 9@sunt&[]Ðt&m=D[]Ð8t́ u < u R< t< t:t d$[]ÍvD$D$@$:uڋw$otD$n$O릋t$NQ뒡‰$T$/wi$Y$n$\$C'USd$$$/$\$$uv@t| t\$$D$n$}d$[]ÍUSd$E]t$L1t$~$蓛$\$'EEE d$[]ÍvUd$D$D$$0ED$E D$ _Í'Ud$D$D$ $ ED$E D$ Í'Ud$؃=tu t&t xufD$ !nD$D$D$p $ÐUd$D$D$ D$$蓿$Ít&USd$tV1ۍ& D$[$j%ңud$[]ÐUWVuSd$}4$($܍$z$菙$\$#<$Y$n$|$U D$T$$4$D$\$$諈t$=@ u @d$\[^_]Ív<$$$|$U D$T$$ 4$2D$D$$&녍t&USd$܋C D$CD$ CD$CD$C$=t)CCt$ҿ$ʿd$$[]Ívx΋0#t<H0#x(CD$D$$S$T$:tt&d$$[]Í&USd$$ 茗D$@$D$2=CtGMCɡt d$[]ÍxD$$9C뛍v'Ud$D$E$9ÍvUd$t* u($At--ÍȐ&UVSd$t$  $5$1o#mD‰$覓$+#ut-\$$,O5ta4$kÉ4$@D$ D  &I d$[^]? D$o $NÃD$$#&'USÍd$=w2D$$#d$[]耸UWVSd$eE1$FEġt$Eă$D}ģEEM؋UԉM U1ۀ9111Oty1Ƀtu܋}uԉ}؉1ɡ 9]~fM؋UԉM U܉߉ڀ<tbE܍_D$ ) 1UD$L$$蚺Uuވ 9]Ee3uAd$L[^_]ÍvUĐt&[9Ӎv;}}ˡUčv89fUSd$]t$蔺CC Cd$[]:v'UWVU}Sd$E@$U] M<$9  @EML)D$ t$D$0n$MU $<$U@JB)t)9s% tt&x Pu 9ÉEr‹EMщ1Eu)u$d$|[^_]Ít&$RD$T$0d$|[^_]Ud$$]u}։ωnPPPPpx tO$]u}]g&UWVS$Dž\0]$0eE1运DžX``04…tL![ T\X\O9 >GXD>…ush ۣs=u T<@084$DD$D$qÉ4$W$ODƉ$5@<D08=Ue3  $[^_]Ív@09}4$<\D$衎ƋX~D$D$n$D$D$$ tt v=$^d$1[^_]ÍvD$D$$tfuf< t< t< t{u t6t$znD$ft9t< t< t< u [9uts\$|$4$3~&D$D$$譢D$$\$踟$P=juXt&$zCt9D$D$n$AD$\$$L$5^TUWVS$d'MUEÃ/EEE$@yE̋u}E]EEEE@E1Eu}E1}t E|EЋ| } u]ԁt&EԄnZ;]|.Eȍv@@9}ủ|EȉD$4$qxE̋|MEЈEt&EąF}"MMS,E2})N}DEű]< ؉ @< t)9Mut8E̋}:M|$L$$|y|]e|$胟EԄEE|t&Ee} pB;E|0MȐt&I@9}]̉|MȉL$$vE̋|}T ~ |t uRM̍ZEЈEąX}t E$軞Uu+ MẺ$[^_]Ðt&Eԃ} EEԉEfEu<&]ԁtJEtE̋}<8 dM̉NEtāerMԀu !||}ҍZNA]Љ] ΃~|e]À t&E}E EJMEԉU4 E|WuЋ| pt5|0} E }#~|vEԃ$ }< ~|]9]}̸<_Ed<UӉU}~|E;E|#Uȍt&R@9}M̉UȉT$ $sE̋}̋u7EЈ[CK ~|0Z;]|0EȐt&@@9}ủ|EȉD$4$AsE̋|MEЈE}9}2EȐt&@@9~EȉD$Ẻ|$rE̋|]MЈ E]fEEef@< tE}?E̋uE:JM}vEԍr4u UT}} u85~U|0E9E;ƋEȐ@@9~ủ|xEȉD$4$qE̋|x}̉UuЉ|x9EЋ|x( u }&   YD M]EEԃt ]U3}#uEXEwt&]#E#Eu E@9]Eȍ@@9~EȉD$Ẻ$pE̋}̋M}ą}\Et|oEt9}(}{|t&}$et&MEE)9M]V}})fBE@]UU)U~|MEt]&E@k} t ~8|u,M ~|eEԃ$ t&H9 Eԃ}' ‰t<|,UM $MЉT$ȉX E-}d l~|EMU $T$ D$D$J>}Ɖ<$mmEEuE[E}(~|EE(^}[T}$w~|\M9}t$|$$|p|E|e$z]EE|E}} JEM];]|"Eȍv@@9}EȉD$Ẻ$lE̋M̋U<Ủ$ԔUt M $”D$D$<$]D$)D$$EdE̍$[^_]ÉًEf@@9~ủ|EȉD$4$lE̋|]}E̍t>d8} ~|bE?&]}uЃ}zU}wMEL$$'''$EE@gk}[}dEtE9E&Uȍ&R@9}M̉UȉT$ $jE̋E̋u؉t$$]U}<$~|MEUuEEt#;E@E̋U؉T$$膕]MM $m}"u=l%~ |tEu}Mt$ L$D$D$<$ Ɖ<$(iED$D$4$!3E4$E[E+} Bu5~|0}̍ttgE~E~4$E|t]̉$譍Ed#Ủ$薍Ed E9&'UWVSd$E EȉUĉMt `TEE E}"DE$@E@~eUM Ẽ E1EUM/GE9Ẻ 8Eԃ EEԉEԋ}1}'t E$ Eu#uCEԃu8tUD:< t  t~ |tMEe }'1)lj}Pf[@9}Ủ\$$cE"'E Ef ( &}'tu\~ |tEGE9|v[@9}Ủ\$$cE̋Ẻ 8hf&;u?E9EtEt}{&;uu+E u%|WU9|&Ѝt&[@9}ËM\$$obEMẺU8Utv\U9Ut ||Ut E_f$oeuFŰE]tME̍d$|[^_]Ã{~|fE x9 UMԃ' Mt|UMT$ $E-}d3} l~|ED$ EU$D$D$0Mlj $_U^E}EmEo~|dW9}Ẻ8L8U[@9}M̉U\$ $`E̋Uʍ&G9}Atu!~ |t E8M̉9}1v[@9}M̉\$ $_E뤐t&~|mt&\E ~|M` }`=E3{t (~| 1;u)E({[}dEt&E9ED$EEЉ$؉UUЋ}M $輆$v~|vMqt& ~|M}"~|MEL$$`1`=dE,Et&E92ED$EEЉ$UUЋEM $Ѕ{([yE''D$E$'E:Ẻ$tD$D$<$蘅UMD$T$ $袂EdE̍d$|[^_]ËMt"tbEt"E9~9MEEЉL$$EEЋMU$Єv[@9}Ủ\$$\E묡l~|vED$EUMT$ $D$D$NjE$m[ED$D$<$f%E<$+EmE [@9}M̉\$ $[E I $ L$[,[@9}M̉\$ $[E}[p&>EUD$$}{1EY<$%E<$R1}уMU1lEMEL$$][1EẺ$EdỦ$܂EdU)(d$D$]ÍE$1u}/Ƹdtl1)t~h |u[E$ZNjEt$D$<$uED;tEԉ4$'Eԋ]u}]Í&EUԃ$_Z(Et$D$G$E)EUԈTED1댍t&UWVSd$@t,5@vd$|[^_]Ðt&%=O vn uރ#  uAt+u'H |7&-=XCЃ EoEEEEE1}ECЃ !E1$ E0vVX9}j u t&tE t| '!cuĉuof9}XD$$Wl<>‰俈M9ÉM&EuNtH$=|7$}t%t$=|$>u#t# |#|u%t" | "t$&uz |i }t& ZMp5T)(>Tu<o([|- [fJfM~|uą  H \uUE>sv~|-EЉD$$ad؍d$|[^_]Ã@?+!t&M(M[eXH Lt&AYg==u)R=(G :f/<0U$aU~|E]$[ED$ 5=dETX9t&9}XD$$0Q0[v\$$A|u{u*k|F'Eă"K|:$~|$P@$$@VX90\$$vf{$^xEE=]}a=jt}"j@DUEUV9}XD$$O6~ |VJ91()E($EăD$-=dZETX9 0D0(vt&of<=#w=%lt&~| =M\tM@\9eOtu>{5=`  E8]x]xd$|[^_]Ð J9 ]1`D$E$&-=dETX9}jU0v|$$Pxu1" EEE<$!uEE9}XD$$Lq>=t&5t l~|Qt&1t. u9 , H D 1O% t&5Tt~ |t }fEu=u&~ |tu,t&$L‹EăU$KU BL$$svEUtJ}tJu U $D$ZUtcz5zE u/v|(ttUMϦUMt]t&uSz5tOuFvr(_U}Uu5uRv uuvUD$$eU=@3 @EċEĉ8{'B1ۃÁ=  =X BfJ9P])UEĉ$(D$-=dETX9}JM 0v|$$Htu]<$5qEEf9}XD$$H=#= |&4BЋ@+=t&@ D$$_H&{g(VM[ $EĹ]D$d`ELX90L0vT$U$rUuEE$oEEguĉu,& u|1)KJ?M ȉM]  =1]v^ 8uD$<$wuڋ]===y=)=={}`uR``t&=uAu>iE8dxoxq= t= t뼐o&_v Mĉ e l: nuN: nN: nN: n t&D$$<$kAvM-~p~fMD8}> U$RUD$$nEЉ9MV@ D$$'C&9}XD$U$BUH9 (UEăƒ-v;l赾&   YD &DD&4q Mf 9}XD$$Ayoy :f~nJ~@ɻ \t&===u!v=(tBtt @\ 1EF<EE= $UD$PUM U~|ʼ(tM t3t)z=D&=5t& ~ | t XM Eȋ =UXM18)t5 \$$[)uˡt$gU%h=X5  uT$F5=+nu%r|u | }4;+~ |'EH9 EĉD$E$-=dR}bEM܉D$ EL$$D$D$xlj$eED$D$<$É<$eE܃E܋XD980\$$hu܅E5$e(&~`{~>u!&u|u~ ({= UUXE YU@2D$$X'&<譸-&]$!;‹EăU$;U BL$$eU.D0)vE&/t&EEEEE ~5| f=(P t~F5|u9 R~5|7߉ )& E܍Dv9~XT$$9@ D$$8 P  8$OT=@%.EU܃T$ $D$D$lj$`<$É<$`$bER $T$'8£R $T$7£'<6t&U}$Eĺ{D$xUTf9~XD$$7x1EB踝b=~ |  j&$D$D$$X_D$E$i\]u&Z~ |2(4t&~ |5) f" EiSUD$$_RK>t+ tDt:ZD*{~ |t+Y*I==ۘD$D$$]D$P\$$Z$s]11ҋE$ f=UD$D$l$L]D$P$[ZfD$D$ԇǍt&EEs-3$)}{zB}&j@U]} S<~(}(};w=u5=t)u!v=(tUUtt= $ ta@u[PE$U^Ǎ@$4ƋUT$$^M|> t> >tQM=5Tt} %?Uy .,%#U:`R``ʀt<~N}{DB}&v5U(} f}(};M} U,U&U1ɉWVXSÍ$DžDžDžf F9'%'='FD$]%)t$<$D$'[T$G $D$Z;t4$XCG4W9 <ƒq% t,tXQ =/Džw vww;`ʅ+4NjD)lj)pxG3֍@@с[ &}t&9[t,tߍvwf6wu6}tDžWHv$pf; w' }"t&=gо;t$iV$,[^_]ÍvDž&$nffҋy ;Ѐ9W t[=@1#!1=/)x +F07}wWF !Ƌu2Y7R7K7D7ơ4@4t4D$@D$G$=ơ46@4)4@D$GD$G؉$=ơ4@44@D$GD$G$F=ơ4@4D$ D$D$G$AƋ_D$ D$D$G$AƋ)D$ D$D$G$oAƋ7wWF EƋu2G$;ƃHD$$n@ƁHzwWF ƋuD$$n?ƁH1D$G$?ƁHwWF iƋuD$G$]?ƁH$6D$$n)?ƁHD$GD$G$:ƋYGD$GD$G؉$y:Ƌ-GD$GD$G$M:ƋG$:Ƌ$28ƋwD$D$G$9ƋD$GD$G$9ƋgD$GD$G$9Ƌ<7G7.D$G$7Ƌ D$G$7ƋD$G$7ƋD$G$f7ƋwwGwGH wsGH75Lt$D$ D$$p>虊/HLD$ D$D$$'>ƋGH75Lt$D$ D$$=ƋGH75Lt$D$ D$$=ƋmHLD$ D$D$$e=Ƌ)GH75Lt$D$ D$$&=ƋGH75Lt$D$ D$$<ƋHLD$ D$D$$<ƋgGH75Lt$D$ D$$d<Ƌ(GH75Lt$D$ D$$%<ƋHLD$ D$D$ $;ƋGH75Lt$D$ D$ $;ƋfGH75Lt$D$ D$ $c;Ƌ'HLD$ D$D$$;ƋGH75Lt$D$ D$$:ƋGH75Lt$D$ D$$:ƋeHLD$ D$D$ $V:ƋGHLD$ D$D$ $:ƋGHLD$ D$D$ $9ƋHLD$ D$D$ $9ƋEGHLD$ D$D$ $<9ƋGHLD$ D$D$ $8ƋHLD$ D$D$ $8ƋwHLD$ D$D$$o8Ƌ37Dž"7Dž17WGƋu2D$W$T$5ƋGD$W$T$4Ƌ$-ƋnGH75Lt$D$ D$$k7Ƌ/GH75Lt$D$ D$$,7ƋHLD$ D$D$$6ƋGH75Lt$D$ D$$6ƋmGH75Lt$D$ D$$j6Ƌ.HLD$ D$D$ $&6ƋGH75Lt$D$ D$ $5ƋGH75Lt$D$ D$ $5ƋlHLD$ D$D$ $d5Ƌ(GH75Lt$D$ D$ $%5ƋGH75Lt$D$ D$ $4ƋHLD$ D$D$$4ˀaGH75Lt$D$ D$$^4臀GH75Lt$D$ D$$4CHLD$ D$D$$3GH75Lt$D$ D$$3L=t =ߍ;9 C)ЃW=A=t =g;0V=z9ED$D$n$;D$t$ D$$8  1GH75Lt$D$ D$$ 2ƋD$$.ƋGD$$.ƋHLD$ D$D$$1ƋCHLD$ D$D$$;1ƋG艅w>uvD$ D$D$$0‹F ƋuD$|D$$o,Ƌs7lbXG@t:̀1@t̀1GH75Lt$D$ D$$/ƋGH wGwGH wGH wGwpD$$G,ƋKGD$$#,Ƌ'=7 v7G8D$&D$$*ƋD$D$G$*Ƌ/=7twu@e;T51+~ )Ɖ5GG8D$&D$$)Ƌ=tt@;B=Gwtmt@U;CD$D$G$)Ƌ D$ D$G$(ƋG8D$&7t$$(ƋD$;D$G$y(Ƌ}7v7o1cH7X1Lw p7?71tF GF"71tF GFD$$D$")ƋG F ? E@@D$|D$G$'ƋD$;D$G$`'Ƌd7] S;IG85D$&7t$$'ƋD$;D$G$&ƋD$ D$G$&Ƌ$n1}111kD$&D$$&Ƌt!j$5k D$&7t$$T&ƋD$&7t$$+&ƋD$&D$$&ƋV F 2F 9F 2F &UWVSd$ċEU PEȉŰ] M=d$? 5LMЋ M܋ M؋ M$rŰELT$$n]t  1ۍ&ӯ=/t7 \$$s%蜯=/u qEM=d$}ԣP E܋M؅5L t %ht ty]d$<[^_]!8:xt&U$Ụ茌U̅ۉt$wWh(t&d$<[^_]Ë5 u Tu $$&Ud$c Tu1tw9 Tt֍&ÍUd$ȉ]u}=Ë5(W=tx==zD$D$$/D$\$$,1ۋu؋}]T]ÍyuB$TfKt؋u]}]Ív!t-D$ D$D$$=$><tt )$nm+D$\$D$ $É5T؋u]}]fcT)D$ D$D$$d3i D$D$$-.D$t$$8+4$-jv4$`-ǡt t  =WD$ D$D$$D$ \$|$$z t$ST.ht9D$D$,$,-D$\$4$<*$,nD$D$n$,D$4$*Af$=<=Dt&Tf1;gqD$D$ $5,D$t$$@)4$+$1^R<$VQT&=8=tcfD$D$$+D$t$$(4$Y+$1QT=n=uP:nu@:nx N&D$D$i F7fBt<=ZzPz=4D$D$X$*D$$'裨=uD$ D$D$$wD$\$D$ $[D$D$$3*D$$B'$EbOEdt>D$D$P$)D$\$$&$)%D$D$$)D$$&t&USd$c=Tt ؍d$[]Ít&D$ \$D$$GÍd$[]ÍUSd$=T t ؍d$[]Ít&D$ \$D$$Íd$[]ÐUEt.]Ít& ]fUWVSd$Uut& u#t u11d$؉[^_]Í t؀+1-E A< 11]ؿ ˉu܉vt=sЉ w3Eku E0U‰EEUE؋UU܃u]؋u܋UHۉ؃d$މ[^_]À-EEW11ƍUEu @tRЀ v1]f]ÐUUu1<t 1 &5D$$ʍ[9Ӌ5t]u}] 녅dYUWVSd$E =5]t\;~uSڍR9~ruVلt}<:ty t&t@ :u9ljt_|$$D$OËu؋}]]Í ;<:u ;뚍v1ۋu؋}]]Í&>9t>$؋u]}]ÍUSd$E ]t&;/t!\$D$$ŝd$[]Í$@ $UE] d$[] t&UVSd$];~tW$ $$\$ À;/t$\$D$$AƉ$d$[^]Ív$D$붍t&USd$];/t($D$/pPEڍd$[]Í&{u҉؍d$[]É'Ud$D$/E$6ÍUd$$ED$ED$1uE%=@fUSd$]$1u d$[]Í$D$d$[]É'Ud$$ED$ED$Ðt&U卤$(]]ۉuut>tZS33V t ]u1]ËSXC\3VX3F\ ‹]u]fE]D$\$$t봋E 8D$t$$kt두t&USd$]x$WCx$HC1d$[]fUd$D$D$E$~!Í&USd$]D$D$$M!¸x1u d$[]Ít&$T$D$!d$[]fUWVSd$ԋ]}[„t;u t4u[~t$D$$ uܺ9ud$,[^_]Ít\$<$Xt֋M uJ<$d$,[^_]Í&~I=XXFt&$9r<$v뜸ō&USd$]$ x/FD9snUЋMԉ]UM tT@9sM8/uUMf؍@/ux@aIf]9)).G.G.Wt$D$$D7&'UWV}Sd$EeE1u] 4$\$D$ D$ |04$\$D$ D$ (Ɖ u]۸m|$D$E$D$ Ee3u d$<[^_]Ud$$un]u}]At/$~ D$\$4$\u ;/tD$/4$uܡD4$D$tljt$ \$D$$멍t&UVSd$]t}D$ D$D$$t:C@t0@0D$4$SR 1҅tQtvuZ؁%d$[^]ÍsFtt$8FsF tt$F ht&@@t딍D$4$Hv4$(¸ҺE‰`Qt&'USd$$$CP@ @C C؍d$[]ÐUSd$]$Y1҅ۉX @ @tSPd$[] Ud$$ PUPU P UPUPÍt&USd$$$ CPUP C C؍d$[]É'Ud$$uu]dtt 4$0ƋE sCC ؋u]]ÍUSd$] $ U@X@ d$[]ÍUd$$UPD$$ Ud$$ ]u] upXE E]u]='Ud$$ ]u] u1pXE E]u]'Ud$$]u]u }}xpX E E]u}]Ud$$Uuu ]}U}UPxtt 4$EƉs ] E]u}]%t&Ud$$-UPD$$ Ðt&Ud$$U]u]u }U}UPxp XE E]u}]t&Ud$$U]u]u }U}UPxp XE E]u}]5t&Ud$$]u] u}}+x pXE E]u}]&Ud$؉]]}uM }CPt Cux ;t!}]M ]u}]g&BuT:uOr~ ;tDf8up~ ;u ‹F@t։‰|$$L$VB؋u]}]ÉfUd$~ @UPU f$UPU Í&Ud$؉]]ۉu}u} tct/{G4$D$}G%؋u]}]Ðt‹uCH x ؋u]}]ÍÁ 늍'Ud$~ @@$$@Ðt&Ud$$$<<Í'Ud$$ uu]}} 4$d $y$t$ C{] E]u}]&Ud$uu]À>u$$؋u]]Í&4$ $$t$ ؋u]]ÍvUd$$}} UM]uUuMUMPx pO@$hut/@t)@t"H ~D$D$$C\$$dC] E]u}]fUd$$]u}u }ËECE{CsC Cv1D$D$$$t$t&$ED$$HE9Uuy<$-1 CEC&؋u]}]ÐC B؋u]}]f$U UԍD8-u$ra1 CfC A؋u]}]fC ؋u]}]fC A؋u]}]fUWVSd$EEȋU Uċ@EUD$B$sEo$1 UȉEЋB$EȋỦP@EE@E܍vE܉$`L~}tŋuЅE:$8ƋEU9|%EEUԉD$$E}ԉt$<$\$ }X\$ D$D$$w}a"EЅE: >v[ t'UЉD$T$$M &t&EЀ< ]ԅE8UȋBUԉd$L[^_]Ðt&VUt&EЉ$D$ẺD$U UWvEЀ< G뎐D$D$ $ U؉EU d$L[^_]t&D$D$L$Ủ$T$UĉT$$UȉB$E'UWVS1ۍd$ċU E$EԉUeE1EEGǐt&9vhuЍ4<$y<"ykv^E܋UEȉ)؉ỦD$U܉t$T$ $Pv[SD9wUe3EuQd$<[^_]Ít&[p<'t<`uEԃH{t&UԃJkt&EȋỦE܉U[4 USd$]$-$\$d$[]Ív'Ud$u1Ð8t$H2D$$Ív'UW1VSd$ċEU E؉UЋU؋EEEEEB0t&< tZ< tV<;tut [<;u9r>ލ1҃tVteuЉU6E܋U̅t$>tQvf؍)4$D$D$}y‰uЉUEUfЉUEU랃uu$ }܋UԅPuE܅CMUɉS EUЉCSE؉$K(] E d$<[^_]wD$D$$cD$Eԉ$tU؋BD$D$͊$0D$Eԉ\$$=1d$<[^_]D$D$$UԉD$$뇸̩E̩E̩}Et&Ud$؋EEEE$$ÐU]ÍvUd$t?;} Í&D$$Í&@?$ ÍUWV} Sd$]$eE1UEu`t&E։}։UĉMML$|$$(Utstl<%[utd[v%cUD$D$$Uĉ$҉T$ut&Ee3d$\[^_]Àsuw?<$@8Bt&E%t&wxLU؉T$D$ $T$h<$MM뎐t&wEUD$D$ HD$ D$$}E9'UWVSÍd$t.mEƉD$C$D$u؍d$[^_]Í&Ud$~D< t<&t $Ioq USÍd$썶uiCtuC$8 C $D$$8[t$KCu$CZ$Nd$[]Í&C8$Q[4t&C$Vl[t&C $D$K$8?[&yC $D$_'USd$]$[Eѿd$[]USd$]$Wغ8Ed$[]t&'Ud$E@$_D$q USd$]C$kD$@C d$[]8='USd$]C$yD$C d$[]8'USÍd$졈9~-11Ʌ~  R9u$d$[]Í@9}D$$봍USÍd$$Zpt;t\$$7d$[]UVS1ۍd$x@uF@F@uP۹<mVET$D$$d$[^]Ít&@$D$F@tF$wۉƺm<EЉt$T$$4$ d$[^]fD$$`Pt&'UVSd$tv$8,ut<;t$$tf$tPCD$C$D$$uҡtu*$:d$[^]Í;t3$8g뾀~Vt$$FA~tŐ&Ud$]Éup@{w=S$vCtD$$$D$]u]ÍC^T$D$$̍t&$CD$봍t&C&tD$$i$D$Wzf$Dg&CtD$$$D$*f$CD$C$D$t&C~tD$$s$D$Ct$D$$pvCt$D$$HkvC~$0D$$G&$>D$)CnvtD$$$D$&CvtD$$$D$&CT$D$$Ȍ^CnT$D$$،6YC&t$D$$3vCt$D$$ vCT$D$$ D$$8vt$D$$&t$D$$l&D$T$$(Jmt&D$T$$*Mt&t$D$$ /&t$D$$&D$T$$t&D$T$$ьt&$D$$D$v$D$^o$D$F$D$.s$D$'UWVSÍd$C11t;t0u {t4$8Cuˉ$ۉu̅tH u{$8_&!$E6u$d$[^_]Ít&C CQljB&5d$[^_]ÐU8Sd$]CC t!$8C d$[]&d$[]É'UWVSÍd$ԅ@Cxpu\vMD$ D$D$$5t&S t$8C d$,[^_]Ít&$$Kf$ICx$OCdt&J$C@ t m.$Nr=t&s4$=$IoQ<Ft m|<)*ofC@$D$C@HvC$s$^F$b<F t mV <)t@i<F t m<)sot&CocsF$_D$v 8<Ko>6 m*FZ$<F=<)t mF |uHo농t&s$S!8F$$nF 8 $n8F$\<F)C$o^sF$oD$pD$$`txD$4$ev@\$4$Tv-@v%ED$ |$t$$Et&EEt\ <~R11&t& EӍ;t?bR79<~/tڍ MӉUĉ|$L$$FU1ۍ&>u v$t >[t b>~ƃ 4$UWVSd$ԡD]+D$ D$D$$*D$D$$ tJ8m&EljD$CD$D$ D$$uǡD$D$$Ed$,[^_]'UWVSd$ԋEEU DU]u}D$ D$D$$D$[D$$Ut8D$D$$Ed$,[^_]>t$ D$D$$~UD$D$ D$$X?|$ D$D$$&9D$KD$$ UD$D$ D$$t0>t+t$ foΉ'Ud$DQD$ D$D$$PE@D$D$ D$$'Ðt&UWVSd$ԡ} D]Um938D$͍D$DljD$ $tmC0tĀ>t4$'4$' ƅɸ8t$ D$DD$D$$T4$uD$D$$#Ed$,[^_]4$ u<8҉t$ D$D$DljD$$D$D$4$v{D$ D$D$$zt&USd$]D-D$ D$D$$,CD$kD$ D$$D$C $d$[]ÍUSd$]DD$ D$D$$CD$yD$ D$$vD$C $Cd$[]ÍUd$ȡDE]u}] }uuEtk\$|$ D$ҍD$$]Eu}]vD$ D$D$$u;u)\$|$ D$D$$f$}uT$芀uVt$|$ D$D$$A9E=4$0t&$뮍t&D$D$$h뎍t&Ud$8xt.$$8Ív$ݍ&'Ud$E;8tÍt&fUd$؉]]ۉu}u x $ntjxB4$9t64$D$D$p$$|$\$85]u}]ÍvD$D$H$dE] u]}]t&D$D$ۍ$,E]u}]&Ud$$D$fUd$D$E D$ ED$$6Ít&UWVSd$]ۋu t4m&EƉD$C$D$u؍d$[^_] Ud$E$D$D$$ÐUd$;E}:@@@@@@@ߋ ÐE韱 USd$]t$W;}BCCCCCCCߡd$[]Í]d$[]v'UWVSd$]t_B{w.K/|utC$C$4$tC3tC$멐d$[^_]Í&USd$]tACt$Ct$C t$]d$[]&d$[]É'UVSd$]uCgCCCCCCCߡt(C3$@;|$軯u؍d$[^] Ud$ȉ]]ۉu}5C t$fv?D$ D$D$$$&]u]}]t&$4sF$zF$o4$뽐t&C@$RC$띐t&sF$F $4$rfsF$ F$F $4$l?&C$(sF$24$: t&sF$F $F$F$4$t&C$CE@$_Ep u)vF$F$(>4$uڋU$bfsF$ F $_F$4$\/&C@$BC@]&]u}]ÍvUSd$]C$C $CtEd$[]fd$[]ÐUSd$]$]d$[]U8t4 u*u(t t( t# t]Ð u͐t&@]@UWVSd$ĉEeE1ɉUĉMȋ]EUE1Ủu u &gfffy))ÅҍC0ӈuׄutUЋ]fI2 vuuԋ}ątCUԋEЍv.]ąۉu~'Nj]ċU <I09ˈ7v}uԋUȅtUԋEЍvsuԋEЋUUe3d$<[^_]Íغ]Կ U؉Ủ)gfffw))ҍA0ш;u11Ʉ]ԾtMЋu̐>Ruэrغ)k<)ӋU mum,U1U9D@D]Ð&UE@@ @@@@@]ÐUEPPP P]ÍUEPPPP ]ÍUE;Dt]ËE \XX]ÍUSd$]C x;E t d$[]f$hC d$[]Ív'USd$]Cx;E t d$[]f$(Cd$[]Ív'USd$]Cx$CC x$C CCd$[]Ít&Ud$$@Ít&'USӍd$x$x$~d$[]Í&UVSd$ut6~01 [9~F<t$8F[9d$[^]fUd$D$D$p$]uÉC$t$\$]u]É'USd$]Ct$]d$[]&Ud$@Ut%: uT$$z¸@uÐt&1Ít&Ud$tÐt&D$$$b$6D$$b$5ÍUSd$@]D$LHTP\X$$\$@E Dd$@[]Í'UVSd$]t^$$諧ƋD$4$D$ OD$D$4$[$Qud$ [^]fd$ [^]Ð&USd$]tU$it$$CC CCCCCd$[]Ðt&Ud$XuÍ$@lÍv'Ud$$@MÍt&'UWVSd$ԋ]1$Q$fƋ$Zq@C‰$T$t9D$D$ D$D$$謲<$C ‰$T$09D$D$ D$D$$h<$`4$D$D$ OD$D$C‰$T$8É4$D$D$$ud$,[^_]$Pvd$,[^_]Í&$.'Ud$]u]u t$$At$$]u]]Tt&USd$EM Px9t1ۋP x9t"u%d$[]Í&@f@ Ed$[]vUd$$@ED$Ít&USd$]D$$w]d$[]&Ud$衐t$ÍUVSӍd$t$D$$~~4$Zt"t(D$$xd?t;d$[^]ÍvD$$Tyݍd$[^]f$d$[^]1҉tf뎍v'USd$D$$V$ u+d$[]Ít&D$$$xd$[]Ð$QD$D$$$\$'d$[]UWVSÍd$ċ}0Eu 2EE  0s E‰׉t Tuu$ӉƄt T}@]܅t2ME0tU$=E$蓠$`Nd$<[^_]Ít&Pp uu$yND$$rNPt&Pp b=T$yMCt& t" t EEM$`?ND$$0[O$B.ME0E[&$mTM&uM$mMMԡtQMԉD$$Mu̩$~EljD$DM‰׃UǃE$Bt-M%(#҉U$$U$T$vED$$ LE$L D$L$B2MUd$ȉ$]u}PW$$A,u;Ht$=<$$ $|$H6t?=Dt511҅tEU$YEU]u}]Ít$C$Ɛt&$`,v11҅t]u}]Í'Ud$D$$ED$nÍUWVSÍd$ċЃEtCtCtC-C H=M,81=DE=CD$U܃@ $ǃ-U܅mDtMt=L MCt$U܋@ $aU܉ƅt-mDPRMt[D$t$<$9mtE܉<$|E܁mtE܉4$fE܋Utd$<[^_]ÍvC D$ t$|$U$hUsfCD$U܋@ $wNjUt&0CD$@ $Cƃ-m=PDC t$$A_mCvC t$D$ED$C|$ $Wfx=! t&}΁}~ExCeCXvCEލCD$@ $vC MD$CD$t$ L$${D$ D$D$$覾$Vv'Ud$]áTuD$։$莪u2 Tt u t]u]Í$NdtBP@t7t͋D$D$$$\$`롐t$$z]u1]$U&Ud$$uu]脙É0u@؋u]]Ð4$`Ct$D$$ɿ؋u]]Í'UWVS$]u }eE1|$t$$$芣tVD$D$h$$\$1~Me3 W $,[^_]Ív$O8 t $f$sRDD$$ D$PL$$$T1  $D$藘D$D$0k$S$\$~t&D$$X  D$PT$$:~ #ɐv4$Z@U<M \p$t(x,|0E4E8E D$D$$蹹$t$\$I4$a~(& 4$,\$$ڐ<$ ~<EBEBEB EBEBEċBEȋBE̋B EЋB$EԋB(E؋B,E܋R0UƉ$DžtYEދMƋD$ L$ D$|$$褻U9MDž4$-uEƉ$zE̋ D$ $ED$Ɖ|$D$4E9 D8v@uA1҉|$\$$֐irFk8v@uAQ  j;e VNj f < t< t < tI9&ED$EE≕Nj HD$L$ @D$T$<$E⋕;LDž$r2ED $躺Epx|$t$ @ <$t$D$_ljE;|$Dž $ӵsD$D$$$D$m\$s~ZG4$D$JD8^8MD8Fk(D%vΐp[u8tt@؅ڋ;t D(fΐpu8t3@ЋDž DžD$+$rQ@fUWVSӍd$ t F4$$Au "6#E}FEEt @@E̡E0u  MH$Uµ$׋U$T$hU$T$M$ @Et M t E $q2E}ȅtCC EE$BED1Eȅt S1t CCt C@UMCT$U4$E̋Eࣸ`}EuB=t9E9t.D$4$"B =t $o}}u } }=Tt=u =u+}=0}}Ủ$&/uȅtCCE[EȅtCC1Eu&Ue3\$[^_]Ít&EUċMPEȉL@UM̉<4$HDTrX@Ѓ?))É$H`1QDžd)kdX)lj8(v`d3d%ztCd9|ƍ[@9}`4\$ $YG`4듍vJzt%]PqЉ< Dž$w&z0$qJDž$1ҀlgEoRfUfSPLL$$эEЋ$~d9~zEЉD$`d$q`TL$ D$D$$ lT$n` $Nn[@9}`\$ $E`b$\:ƸDDd9|$f[@9}`\$$E``d J1ҀlEDHL$8XT$ $1ɍEd9} UЉT$[@9}`\$$E`Ӌ@Fx |E$r|M UJ9M$dU ËD$CD$B$SE$\$$\$$ x|$$E$D$z$L$dFP1JvtNEM D$ L$|$D$4$fx<$nD$T$$ou1u$L[^_]f$L[^_]Ðt&$D$D$$_j$iҨ轰D$T$$n$L[^_]fUWVSÍd$MĉUԋPHB |tB&;D$ D$D$$3e$t&wŋ}ԅjB1҅t HCP$XSJ ^ ufB$-d$\[^_]ÍvtBtHBtHC@$z]E} D$ EԉD$C|$}ĉ|$@$-d$\[^_]Ív$BlsE D$EM$Uԉ؃'uut=0t$\t&R1otJB ɉB=E }D$Eĉ$Ủ|$ D$D$ U̅ JtJSRtJ} E|$D$ }ċEԉ|$D$$d$\[^_]Í} |$E}ĉKD$ |$D$$et$BdsE D$E$MċUԉ؃xtt&gUEUEȉ8&;$tvFv${$ 4B)&&R1JEȉUŰE#f Eȉ $ŰEt&E`EEȉ$EUE]Ð&UE]Ð&UE]Ð&UE]Ð&UE]@ ÍUE]@%Í&UEP1t1]Í'UUB  t 1]ÍR;u]U1MQ  t]ËA;]Í&UE]@%Í&UUB]Ud$衠‰$]]uT$:ƋSt$cs؋u]]Ív'Ud$avUSd$EE )u] Md$[]#kvd$[]É'USd$EE )u] Md$[]j&d$[]ÐUd$pvUd$؋E t8u 1EÐU$T$KtEݐ&Ud$؋E t8u 1EÐU$T$KtEݐ&Ud$ltÍfUd$ExCt諾t&v'Ud$3vUWVSd$ҋ}tatG71<[݀t.)u|$$iu׉}݄d$[^_]vd$[^_]Í&D$ @uD$D$!$^lt&Ud$t 0uÍt&$0ÐUd$t 0uÍt&RD$0$V0$螇0RUd$,]0uS915[0]u]Ít&@ ,D$$7ƣ0몐t&Ud$D$E$趶Ít&USd$]t$_Ct$C$M]d$[]_ USd$E9tvX$9uB$Vd$[]Ðt&USd$CtUMD$!‹E$U܉D$\$RKU܋E=>M2@W`;I=P$Hd$,[^_]Ít&~p~d4$JUD8+$@@t~t$J$rHd$,1[^_]Í&D$ D$t$$iM&{F.{S${<$" t&DD$$Zt&@IU܉L$t$$IU&$ f$£t&Ud$ȉuu]}] 4$t$$$q} ]u]}]=t&S C U$=UljS 4$CI$R$t$I$\$D$ x]u}]fUd$ȉ}}]u<$u 2@t$FCCt$mt_4$g=CS (ЃɉCtЃ C€St `$tE؋u]}]ÍC룍&<$2H$G$|$H$\$D$跟‰U{UÉB,&'USd$PECK؍d$[]ÐUWVSd$ċ}eE1$n@tbptF upE 1ۅU؉U~EMD$ L$‰$T$ݯى\$D$ L$4$[q9] Ee3yd$<[^_]Ív} .;E 1ۅV~7t&R UЋB$D[$L$U9^ B;] }E؉EfUD$ T$$L$D$ \$D$4$[9] ;&4$!U1ۉUԐt&‹ML$T$D$ $谮ى\$[D$ L$4$Du&$nK&FX C$nC‰$T$CwG&'Ud$D$$dEdÍt&'Ud$ȉ$]u}É։M}Nt]u}]Ðt&$0Up Pt xԍ&'UWVSd$ԋ}<$t@ tV;uX1ɋt&Ct9CtE[uD$D$$1pB$CzFE띍vCF@t VSMM…u\FBKBJ ?It֍d$,[^_]ÐFuSuu$UUЀFȍt&ME $C$M$L$HDUBqt&Sndu"1oM$茘CM<$1AFfUSd$E$-t@@u<$@CK@؍d$[]Ud$E]u$t@uƉsK؋u]]Ít&'U1d$UtBu @u%BD$D$B$ÍvD$ZB$3Ít&'Ud$U}]u} BtSEME<$L$J}Mԅt$T$CÉ؋u]}]fE ?U$ËUЋRu$D$D$Ɖ$"?؋u]}]ÍvL$BM̉$IËE֋M${v<$U A$"$|$AËUOt&1ۅE ?$t&$UƸmD1ɋUЀ>t ~up1?t)t!t<$UЉMS@M̋UАt&UЍM̉$WÉt$$@M̉|$ى $@Us~t4$?XUqUЉ$Ét$$@U2&$ƸmD1Ҁ>t#~t~t4$?Xf1?t!tt<$Uf?UЍvUЍ$rÉt$$@UЉ|$ډ$?M<$ ?$5$|$?!fUd$E]u}ƉtNʉD$\$$GG (…tW`fʉMnNjMt@Gt$+t tH]u}]ÍvD$|$$f$1돍USd$eE1EމD$E ]D$D$ D$ $0D$$Ue3ud$D[]l:USd$eE1E]D$ \$T$$ZD$D$$BE D$ ‰\$$T$"D$D$$ Ee3ud$$[]9fUd$]u]u tD$Lt]u]ÍuHE E؋]]K뵉'Ud$ȉ]]u}Uu CcuxD$D$D$ t$$ЋCt$@4C(u'Ct `؋u]}]Í&CCѐt&T$t$$D$D$D$ D$$Sm9e<$3X&T$t$$Sƅt$3s(&Ud$E$t EÍ&'USd$]$;LtD$$\d$[]Ðt&{AuD$$~Ud$$mt8u D$ D$$p2É'Ud$$]$1$ÍvUd$$t8u 1E) D$ D$$1tׅxӐt&Ud$E$t2|8tPt}@tÍ|!}^#ÐUWVSd$ԋE\$$18Et&e$o1E$D$ tdiuԿ" u \$čv. u \$먍&9 u \$눍&d$,[^_]Í&ƿD ] \$Q&Ud$؉]]u$8t8u{StY]u]Í&U$T$t܀{Sut<$N$t$4;5l$5l$뫍t&;s]u]Ð4$hvp;h$}h$xUd$ t HtÍt&$tE+@t&'Ud$SvUd$]]u[,‰$T$:Sƅt$/Ks؋u]]ÍUSd$܍ED$$/]3]+1(d$$[]fUSd$+t; tEE  >t&)ii)iɧAȉ %9(uu= 뵐t&d$[]É'Ud$]]uK£($T$Sƅt$T.Ks؋u]]ÐUd$E@t7@t0D$D$$ED$D$$+Í&UVSd$utHtBfD$D$$+$vD$$+^vud$[^]USd$]U Ct5t Tt5$uACD$D$$F+d$[]Í&$uDC뺍&C$UÉD$D$$*]d$[],t&D$D$C$붍t&'USd$]CtQCuo@uKD$WD$$*D$$D$$]*d$[]Í$D$d$[]ÐD$D$$*$D$$*d$[]Ív$D$d$[]ÐUSd$]ttv@tC[ud$[]Ð$䍶USd$eE18.UT$D$ $T$H$[t`D$\$$[HEe3ud$$[]/&'UVS1ۍd$$unYtX$Ft6fxy/pt(D$ D$D$ߗ4$t un$`t.D$D$$TH`$^*D$D$$"Hd$[^]ÍvtD$ D$D$ߗ$ `$D$\$$H`mv4$`]t&'UVSd$$keE1 t 8KEE1]ۉ > sctqغQD$ D$ )B0Ekd)Ӊމ$]t$u觱0D$ D$ $t$E0EEED$D$$kH`Ee3d$0[^]fغgfffE)B0E)Ã0]둍t&0]Ert&U$T$Y]D$D$,$<($\$@(1,[0댐t&Ud$<tÍ1<ÍUd$D$ E $u $$+EÐ&Ud$$]]ud++ $$T$豒Sƅt$'Ks؋u]]Í'USd$E ]D$E$d$[]USd$E ]D$E$D$ D$#{d$[]vUd$ȉ}=u]ut]u}]Ít&E$]ۋ~~1f\$D$ <$D$[9]뢐t&Ud$D$E UD$ E$T$(EÍvUd$$]]u}Ɖ$NjC$:4$rL{؋u]}]UVSd$ ҋ]tBCt$K%5 4$}'$$t$&(Cd$[^]Ðup$bNUd$]]u3‰$T$zSƅt$$s؋u]]Ív'Ud$]]uN‰$T$*Sƅt$y$s؋u]]Ív'Ud$D$ D$E $n& (t EÍUWVSd$ԅEt}]u,&މ R ɉ[t; y9΍I$ L$豾묍&E$m#t&d$,[^_] Ud$؉$]u}É։t]u}]Ð$p xH]u}]Í&'UWVSd$]eE1s]}t7&Ӎ [t=u=E}u{`$D$f!D$$HD$Ci$4  D$$D$D$$ޔ$D$$D$2h$D$&h$$D$ t)=T˕ȕ$ϕE‰D$oH$D$D$̩$.H$D$D$̩$==@ MD>L$\$$E$Uu8=TtM $Ut}UD$|$4$4EUEU$ËUPH`M(@f $^{/C$1߉ы=@q$Wlj\$$@4$D$5T@;/t8u "8$$$\$$-λfx =P$At$M8&$X茽`$NiD$d$RiD$$~$迼o8ID$D$$@$3$D$@$.á@8.$h@ s@sHPD$\$$gH$und=/fD$\$$hHx$hD$$n$7t&8D$D$$un$C@1щ $UD$D$X$GU$T$Ut&'UWVSd$EȉU؉MXUȋBEt&;EMȋM̋҉UEԅEӋE}؅@Et$U؅t^}tRMԋq|E܋91ۋE v[9}i8uMD$ $UUu9}BfU҉UxMȋAE9E=d$L[^_]ÅtvE1ۋ8EԋP9J9|M܉ Eԍvp땋EԉHD<$D$DUԉljrÐ&UVSd$5tVt9Ft3vuD$D$$X$1 t&Fu 1d$ [^]Ë@tt趵útF$EEt‰$E뵍t&Ud$E uD$uE]$辽Épt1ɺtKCX ؋u]]ÍUd$$t$E ]uu蠲u]E $t$]]'Ud$$E D$ED$/Í'UWVSd$] ۋ}t1r1ɅtNRuu1ۍd$[^_]Ð[ƐC[u4$kd$[^_]USd$T$$vt$؍d$[] Utd$뱐UPtd$롐Utd$두Usd$끐UWVSd$ԋ}tE8uGEt0t@ uuBEEd$,[^_]Í&ExtExt$E뙐@$轩E11Ʌti׉]&U:ttFvt;Uu$I$^$\$UFvuŋ]܍ E$Ed$,[^_]Í&E\$D$$mq낍vU1d$!USd$ܡu1d$$[]Í@t$ÉUc$E6EĐUSd$$t$؍d$[]É'Usd$U1d$봍t&UWVSd$ĉ$ܦ$1E1ۉuE~Qv<$$$|$ƍ&E܋Uԉ49{t(1t4$$$t$ECEMYۉM{uCDu֋{t;{ds$E4E1Ҁ?ttt <$ƒMUЍD $BASH@_FUNf@C_H ƋED$E؉ $M̉D$M̋Ef()@U=?@vEUd$<[^_]Ðt&D$CD$$%DžMUЍD $VƋM؋EL$D$4$EUЍ=?eR@T$|$$6&'UWVSd$ԋ` 1t$襤Nj1ҹtt&Z1ɅtKR4uN1tr1ۅtZ ;D$$áCC\$$ ttlj4$ t;t$ dtI`d$,[^_]Í떉\$<$v1$ttIE$ Etf녍&'Ud$ tP?&ÐUSd$]$SPd$[]Í&'UVSd$$ËV FCFC1t$VC 1tVC1tCd$[^]ÍvUd$$]u]}qƋCFCFC F CFCFCFCuq{wK/|t"C$F]u}]Ðt&t{1t<$ $$|$y F몍t&C$F|'U1҉V1Sd$]u*fƉ$0utEd$[^]Q|d$[^]ÍU1V1Sd$]tvލd$,[^_]Ðt&$&FFCd$,[^_]ËFC빐~$ ƋG$8FGFs눋~$yƋG$ Fs_&Fމ$CCv~$1ƋGFG$FG $F G$FG$Fsv$NjF@ G F@$[GFދ@$HG{t&~$ƋG$W F1t$F GFsQ~$AƋG$FG$W F1t$F s~$ ƋG$FG$rFst&~$ƋG$DFsv~$ ƋW$UQ$fU$T$FG$Fs8v$)EUFBF$U~ 1B1҅ut&Ep CU$ƋG$jFG$\UFG ?F ut4$|w렐&UVSd$$yËFCF$2CF $C F$Cd$[^]ÐUd$D$$EM‹D$Ív'USd$D$$<E D$ ED$D$$D$D$$PuJD$D$՗$ND$D$$$3vøD$DD$×$D$\$ D$$6gUd$D$$E ]]uuM‹D$Eu] E]u]fUd$ t@t8uYgf$h\t.@t(@t!D$D$$st8u`tÍ&$PtÍv'Ud$ȉ]u}}X15ƅ  4mD$|$t$\$ D$D$$ED$ E D$D$$D$D$$ 0]u}]Ð:Yt$$ E 4m~D$|$\$ D$D$$ D\$ D$D$$fD$D$$d&D$D$$<a$ Ud$؉]Éuۉu.t$ D$D$$E]u]Ív u*~ 4muD$D$$D$\$t$ D$D$$]u]Ðt&USd$s1*E D$ ED$D$$$D$ D$D$$^d$[]Í&Ud$D$D$$D$D$$ E D$ ED$D$$D$D$$Ð&Ud$/D$E D$ ED$$D$D$$oÍ'U1d$D$E D$ ED$$?D$D$$$ Ud$oD$E D$ ED$$D$D$$0u$ &Ud$D$D$$ U$T$^ÍUd$D$D$&$U$T$ÍUd$LD$D$$D$ED$$NÍvUd$$D$ED$$NÐUd$S& @t$  Pt$ $ B… $hÍvUSÍd$T$$z$bd$[]Ít&'UWVSd$ċ@=< u [< t< t5Hth>tcEthUMD$D$$MUt$L$\$ T$|$$D$$fmEum돉'Ud$]u}áL ^=Pt(UD$D$$nU܄X$O$d$\$EkÉ։$t${fǡh4<$U$Xt$X؉]u}]Ðt&X=T$U$U܉$T$WEE+EЉU~N/%^t&|EЋ} É=Lf&t&%B  u=UЉ EEE-E$tD$D$$g*t&u}ԋENjE։9EЋ}11É&t&U UEЋUԉ$t$D$T$ 蒁É+]ut&EЋ}!!Ét&]uU1 EEfU UtIEЋUԉ$t$D$T$ 薂ÉvD$D$$;D$D$$[딍t&Ud$=L,uvn=L,tÍvUVSÍd$t)ڄut< t< t< uu11d$؉[^]À:t =#$9$$@ dPLPPDP HP`PXPhP H  PL$ %$:$\$@DX`dQáLXt$z@t$i @ PH@LPPP DPHP`PXP h$ dd$؉[^]Í&D$D$Ә$/fD$D$$W 1t&R $$T$;D$D$ԙ$ t&U'WV\$PhD$$t`Xt$@t$@Xu 11҅t E 11$^_]fEM t M \'󥍤$^_]Ít&'UWVSd$Du$v t t ft.uߋLDPLd$\[^_]ÍvtջUDHEȋUʀ_E}*<E܀}J}@ Lt&}]E$˓t@tM HtC}]M $ %$贄}]$袯t 8g11ң`d5LvEąw>v!D$D$$Xu܃E118X<@E>E>}E?E?EUD$D$$\E]U5`=dLLPXE$E=u L P=LT! L׀} L뾋ED$D$$MD$D$$E<]\3E]Rtb }#+t-u 8}0G߃]w< Lt,P߃]w < u@<D$D$$j L}^>= L UD$$D$$ $;&uS& Lc>=X L HT ^ L +|t&** L |o L LtLE܅t:Et< t< t< uREUDPu0}_t*E܈Uى<-v-aD$D$$6 L5$H|$=T L T ^ L UWVSd$ԋ=LGw+V+& =LGv--uvÉۉ؃d$,މ[^_]Ív=P=Lt!D$D$D$01t `5d$t$]Uǡhu X6<$L?d$,؉[^_]f(t^Gv3D$D$$11d$,؉[^_]Ð`5dtLd$,؉[^_]=L)ÉtD$D$Q$*봡PDE؉UܡHXEU=hXhRLPvLE؋UܣPDEULH`5dX=hU1ɃX=hPtډ$L$S=hu ¡X<$LXH$;&Ud$L!t~t t&K; 1Ív'UWVSd$=L EUuZ ȉxV1ҋu}e΃!ރuރ=L EUt]u؍d$,[^_]Ðt&MD$D$]$|M끍&1d$,؉[^_]ÍUWVSd$EUvL*ƒ/Et u %t&%t}t |u.}uHtET$ Ut$$T$2pEUfMEUʉEUbfET$ Ut$$T$nnEU;vUD$D$$LUXt&EUd$,[^_]ÐUWVSd$É֐t&L+ƒ-Eu*u}t)΍fuҍd$؉[^_]Í&UWVSd$É֋=LGw4e ft6=LG EEv̍d$ ؉[^_]Í1 EE또t&UWVSd$qlj3v> U19ֹ|9wt&11ۉωދLCv"}D$D$B$UС@  TtM܋A<D$D$G$ǣE܉E9]t}M؋UԋA ;B |$ D$D$4$?tt<$J)D$mD$ D$D$4$uU؋B<t=t Dt&9]CtD$ D$D$4$,9]}t9,t 9D$D$4$99]t%4}:D$D‰4$D$}CD$=D$ D$4$t&MM[}D$[D$4$N}u v;‹MСx $L$MSMt $脻ED$D$$uUD$T$ D$4$st&D$D$B$4UС]؋@ uU؋B<ƒm@xTrD$D$c$D$ |$D$D$$=5D$D$4$4$MЋHd$l[^_]ÍǣYt&@JUD$D$4$CMЋUA;B2m0fD$D$$D$D$4$vD$D$t$dǣD$D$lvUM0MЋ@%d$l[^_]Í&@$AD$D$O$D$ |$D$D$$(U܋=U&D$D$[$ǣpǣt&D$D$B$DD$$=uU䡌@@D$D$ D$ $[M܉Mt&'Ud$EtU9B t 1Ðt&EU 1Ít&'Ud$ U EW&U卤$uu]}h<$D$<$f$~\$|$$z11҉tR@D$ t$D$D$$R\$D$$*]u}]Ðt&D$D$$$t$묍&'USd$t9Cuf9Btыud$1[]f9Ӊth;tXu/$d$[]Í&uࡀԍ& 렋ڣ땍'UWV1SÍd$ԉE䍴&S;t$g$v\9}uݍd$,[^_]Ív'Ud$UuÍvtvUVSx$4$`4$D$0$Ht$\$$D5D$\$$t$[^]ÍU卤$]] ۉu}uu 1u]u}]fh$D$$tD$$dD$$TD$$D<$\|$\$$Xt$$x3|$5D$$%]u}1]ÍË0D$|$$3 vUd$ $D$Y$D$X$D$XD$$XD$$lU$T$(ÍUd$T$D$XJ$D$Ð&UWVSd$d"$}$躞$\$N$KD$$LD$$LD$$LD$$LD$$ LD$$LD$$tLt$$ Jt$$0M J;2 ~M1ۍv4$[$訝$t$<$D$D$9Ed$[^_] JUWVS$]} |(u|$$1Í$<[^_]ÐDžd$D$$4$t$T$$1ҍMU䉅btvJ; |$ $SËtU y t$D$$j$<[^_]Ít&DžJ; uZ{tU9Zt8{ u|$C$S u t6t1U9Zu1f$|$St&D$C$뺍vtStN#Q 9txu@ 9uAA A&D$A$U y t&UVSd$ؘ~n1 f[9ؘ~]4t@uD$@$0x uD$@$[m9ؘt&d$[^]Ð&UVSd$ؘ~e1 [9ؘ~U4tx uD$@$[D$0@$9ؘvd$[^]Ud$ uxD$$Ít&KxD$$Ud$衐t-;t%D$$XD$$CÐUd$u tt=P tÍt&1tt=P tAutUÐ$#S֐$%t$%=P u$8"D$$$y'UWVSd$ԉE䡌Ux9߉t I9uq95|LU}1}@9]vuEt$$zd$,[^_]fD$$8EU䡌5x냍Ud$]ut(D$D$$`x$1]u]á$#tfu͋5|D$\$ t$$蔾fUd$tGD$$Ͻ¸x( t4D$D$$~u1f${u1fUVSd$5X$!$ɿD$D$$ $衿;95;<D$$蔽;t ;$t ;toD$D$ $1$t$żD$D$מ$$藽fD$$|ND$$\$$VNt&D$D$$茼$$f$7$%9tD$D$$3D$p:$M=$m-D$5ux#d$[^]Í&yd% IСd$[^]Í&D$$?t&$3$[tWt&苷D$$D$$萺D$$!듐t&qö$D$kGD$D$؟$F$޹$"fUd$t$ǽ$É'Ud$t$ uÐ$ uD$D$$蛹$3ÐUd$y'Ud$ tÐt&H&U@t9ut& 9tʅu]Ud$ȉ}=ؘu]uU  <89r9v$LC)̘{ Ct$$ܘ95t95u]u}]Sv]u}]Ív <{ [UD$D$H$跷$\$NL$贷Ut&  ܘ<51ۅɍQܘI9t6=ؘ f9t%R9t҉HHσ<t9Ӊ ܘ@UUE܋R$ UUPM܅҉H9},f$C;֡t&Ș-)…҉ȘȘt&{Vt&=ؘJ9 _M9t7u111ɋuS9tI9t9~ߋuܘ1ɅH&9ыu=t ܘԐ&UWVhS$]<$lD$<$<4$Tt$|$$P=ؘ~A1x t9=ؘ~+tu߉<$D$9=ؘՅtht$D$$и$[^_]Ít&uԡu؋$u똡$ؘܘ덉'Ud$$ $rÍUWVS`$$ϯD$$蟸D$$菸4$觯t$\$$裷HtU t~$/7fC8 $襲<$辸|+(ك,u9=b=L$$w1ҍMu )v?t ;_u G $^=U8X@@ PuF&ы9uU ,~_1ҍMtLx D$D$$裱$|$\$裱Et@ИĘD$t$$袵$<[^_]Ít& v;'t&$蔰o=tP~E(ك(!$3D$D$@#$״ 1u5;4$D$6U ;t W9x$谳 } t& D$|$$٫8tԍt&~WOD$D$x$zT$L$$nt&u `$ d;5,JD$<$`t&9(,D$$#vD=D$D$$y$|$t$ &t&UWVS$=ؘu$,[^_]Ívh$jD$$:$L\$D$$Bؘ~P1t&[9ؘ~=4tx u܋ >H[9ؘʍ&D$D$$±$,[^_]Íؘ1ۅ~F=11vR;t,tx up1ɉI9uR; uԡ9dؘ1Svv95ؘA< tރy uء t'y1҉R9u);I뫍vA;Pt 8뽍t&!;Pz07 # UWVS$ OؘBh$D$$ְD$$ư4$ާt$\$$گؘDž1ې<O01ҋ  D$D$H$D$D$$WufUWVSd$ҋ=EυUĉEEEEf55 u}tg}tUt$T$$‰t tUa8U4~ t@1}t E-ĘM^u;v6.;^vuE$D$E=FF ;MԘȘEUEE<EU1wgu&6;ut<1҃~  ЋVu}tp}tjփ Uȋ6;uEuą-W !MЀ}t_~f=MЅ1 1랍t&E$D$yEt @~Ș}MСuu&MЋ] 5,tEd$l[^_]á${5}~rD$D$Ԡ$Ȣ$ТFvUMȃgG Ex UMP EEvMfzt&$4%C8 EEv M!DG Ex B4= kVUM @MP t&}E $U=d"T/t"=P $"D$$$v9M\`WG EG$ҋ UME@;Ed$l[^_]ËVу@y$T$= VMG}t6]t&$du~t&aU$_$uj5 $ 5 u15$St#P t=pt $֋MࡌP F$<u$룋F5 $ %Mࡌ5 P $$1MࡌP 'Ud$$t$}0áu 1ҸM3$t$]UVSd$ؘ 5~K1&[9ؘ~5tx u@t݉$D$[9ؘfu";5td$1[^]&d$[^]U1d$,UWVSh$$uD$$E$W\$T$$M$ 15ؘf0Ltt&Tuu t 9l 1t$ t Nj9u@‹v9uȅtt $+GыuGGG1ɉ1҉t&x Éށ xËށ 9uԅҋG $g$$^$ss$T$E G GG<5̘ܘ=]tG= GD$t$$$L[^_]Ðܘ1ۅPE9ȉ tt&F'8f=\1DžDž1Ud$ u( u t t>ÍUWVSh$}$bD$$2$D\$T$$:5ZMt ]v11҉ { 8tx !t'ut&s{ yz W xB1fNjA D9u쉕1迸vNjA D9u쉅D$$%$D$$$xt&2*8 =tP C CĘwȘ@ U$ %{11҉uc'vCv$$E!'z&9uAt&9uI1Ƀ~ z  C<4@tD$$  PЍH˃]T9u܉% P$ =\u=L =r t]tSxt&tL 9tFYڃ~u-$p  x D$D$$2 $,[^_]ÍvD$$D$L$$D$D$ $y$|$ 蘵Dž|{^1CO<yă耉hf$s!^$a!@Cv뫉Gt=95t @D$D$$aE gD$$SDžDD$L$$vQD$$$t]n$D$$ D$v$ѳtUWVSh$$赉D$$腒$藉\$T$$荑M}@ |M jU 8`5TX8u#M9 t89 ȩD‰D$ ED$D$$DM@m9ZCDօT$ D$$DƉD$8B9u\\$$D$$贉u2U Q9txu@ 9uA U U`} 1ۍD$D$$谏$,[^_]fID$D$0$&U\$1ۉT$$讋D$T$$@$,[^_]fEXD$L$$$oá$,[^_]Ít&Ex8XHj=HD$@$迌*fM@jD$@$ER$tD$D$$萆vD$$tMD$D$$肈$\$D$D$$裌&'UWVhS$}4$\D$4$,$D\$t$$@x PD$\$$$h4$ڃD$4$誌$ƒ\$t$$辋ttx t/\$D$$菋$,[^_]Ðt&HfD$D$T$$WT$UWVSh$}$ D$$܋4$t$\$$11ɉD$t$$NJ<$!$蓂D$$c4${t$\$$w11҉ ttx tDD$t$$<Tu$,[^_]4fHfu t&t;xu@yD$D$t$t$|$Džw'UWVSh$&$hD$$84$Pt$\$$L ؘ1~(=@9~tz uBu捶9b{@D$t$$蛀Nj$u,? #=ؘh $whD$$A $ShL$D$$C ؘ~A1]u}]Ít&UV1Sd$`t$[jt$t$Nr u׋t&t&C$;t$t$rƅu߅tt 4$5ƍd$[^]É'USd$]<t$貁-d$[]Ít&'USd$ t4~ 1 [9~$ud$[]ÍvUWVSd$}u t}~q1ۉt&9~ <u@[9~<t[99}t&$[ 9d$[^_]Ít&$뾋뽍d$[^_]fUd$ȅ]u}É֋}<@t2<*u6{u0u,t4]u}]Ív{tjf$MSu1]u}]fD$[$`?MtP@t*uʀx]uąt뽍x]t&ud[Pt&tu1]u}]ÐUWVSӍd$ԅ҉M_$Sǀ**GلtٍI@uy**@=t$<$Ѓ D$耵9tE܉<${E܃t >u}}Y};u9u}]v9=t$Ѓ D$E$ԴuȈE U28d$,[^_]ÍW&1d$,[^_]Ðt&{t{Lt&*u{(n|*@et&~FE~VU4${E]v;udt&x\MB;uG} fv95=t$$Ѓ D$诳uӋEU 0Et&;u}]&9=Ut$Љ$ D$DuȈEU 0:f$UzUt&1{(t1 t&'UWVSÍd$ԅt8uA]tiv$f[z$pP$\${d$,[^_]Ív{@Et{SUt$MzM؃Eu;]떍vtsu}9v뀐t&9p=|$4$Ѓ D$t7$y$O$\$Mzd$,[^_];]vt&9}=|$4$Ѓ D$vt덍&;}=U\$Љ4$ D$3Utˆ<$x$O$|$yd$,[^_];]b}f9N=U\$Љ4$ D$輰Ut뇐UWVSd$U E~s t+Éփ t) t ud$1[^_]ÍvA$x$0NE] d$[^_]xt&| w`u뮍t&USÍd$$I2 $t $  Ud$Ut5t,t$M$T$T$*w1tÍv'Ud$$]uu4Mát0D$D$$vt؋u]]ÐC֐UWVSd$ċEU EUEtj%M܅E܀8ExuIE1@$[vuƅtJ؋9uG$=vE؍d$<[^_]ÐExt$vE띍v4$LE؋uÐt&F$UuUԉlj$D$T$u6tUt9utǃ}~!UE܉$T$D${u]릍U[E&@$cu$xKE] d$<[^_]vt&Ud$D$8E$fÍt&Ud$ȉ]]ۉu}u }tME1Ҁ;uUME+E9}tMEU܉D$\$ $tU$vr]u}]Í&E{tE{t$zt‰E{EUЉEȃ)ȋM)EL$4$IƉMUJ&'UWVSd$EuEE U :$@JE]t }?T1E@}mM t } ?WwVt~t 1M9rI}v[@Ҹt~t4$UAsUf89sыE\$$HEEEĉt$$sEd$|[^_]ËE}YM9MyE1эYډ$HE}Ut$$QsM]L$$?slExxf$Rrv}m&M E؉L$D$$EԍU܉t$D$$oEU؋MԋE܉$UMEmU:*uz(M|* $GME*%EM* MMt&I@uy*F*@}U$Ѓ D$ED$M9MtE $nE}z}U1EfUM}]uU]ÉEڋE}M9 u];}v=EЋ UMD$T$ $1u؋M}]uUUEEt&U؉E$mU܉$mUԉ$mEUE)9}EugE];uqU :jGEUD$$MU ug[@9}MU\$ $DUEdEEĉT$Ut$$kUUąEE|$D$EEĉ$j}$Uĉ}9}Mċ}vUăE[@9}MU}\$ $,DEUt&EE9E}]u1TE؉$lMEL$$MU _QUMT$ $U M@2vMUEd$|[^_]Ãy\1҉}1ɋ}u]&[9]=4<$Ѓ D$ED$营uĉUM}]uEEeUEME]u}΍f;[=;ЋM D$EUL$$uډM}]uUE E=MEs}]u1U<4$l$BEMt$ $)mVy(=EE}]u1}tT1щMĉыUčYD$B}ECp}E|$$lEUVSd$ueE1f)ġ\$tCD$D$$Wk\$4$Ue3ue[^]Í&Cmt&Ud$]unUÅu%$Ɖ$賏]u]Í&$(ٍt&UWVSÍd$eE1t/t ;t:uC$j$@$\$TkËUe3d$\[^_]Í&eEЉt$D$$Eԉ\$D$$EUЃUuEą4$EEe<D$;ẺÐt&9sj[`v|E܋UEЉ)UԉD$U܉t$T$ $bPvYu1ҍR9Ј v[w9rUe3EuHd$<[^_]Í&v[`EЋUԉE܉Uf$:E@3gvUWVSd$ԅEt?vCH4$Ybt#{74$>u׋CH΍vEd$,[^_]Ít&UWVSd$u4$EeE1E2dU:x uEE11E t ǁ  ˃uىuЋEȉ]̋uED$9EUЅu<}̅u<uȅt < ^E܋UEE)؉UĉD$U܉\$T$ $^`EԃMԅuEt&T T<@P9UwIEUe3uzd$L[^_]Íq^R{NEEEvEUĉE܉UWEEEdUWVSd$ċEeU1҉E])čD$Eԡt @t8uhE @E ux]1t'&{74${4$_uEЋUԉ$T$Ue3uee[^_]Ðt&u&UBE tE뮍D$ED$$9aUJcvUWVS1ۍd$ċu4$EeE1EaE1ҍv9Uvf<\B\WvBE܋UEȋE)ỦD$U܍>T$ D$$]PvkW 8E9$9UԉwUe3uTd$<[^_]f>9[bfD<\t<`t <$ZvzQŰEȉUE܍WbfUWSd$EP1@߅҉ut&ƀtu[D$$|b[vH\$$`Pw4D$D$ D$$Q\d$[_]Ðd$[_]ú"몍t&'UWVSd$ċuD$4$eE1EEZ4$1^E1ҍv9Uvn<<zEYWvBE܋UEȋE)ỦD$U܍>T$ D$$[PvcW 8E9$9UԉwUe3uLd$<[^_]f>9[Zfz;}ԍ[^붍vŰEȉUE܍WZ`v'USd$]tC$C`ud$[]ÍUSd$UE *Mt@t-u@Ed$[]2fuCu^Ed$[]tM Ed$[]f{Ed$[]t&cÉ$9]d$[]KvCÉ$]d$[]t&'UWV1SÍd$ԅUMtICUMqOt[:t$$mNƅuͅtÅt $ËE \$D$E$Ɖ$d$,[^_]Ít&$Ea2NjU댍&UWVSd$]$EeE1E\ƍ@$2E D$$UWUҍ43ىuċut&u yYtVE܋UEȋE)؉ỦD$U܉\$T$ $XEԃvs}ԅuET<T @P9UwqUe3EuXd$L[^_]ÍK~ōEȋỦE܉U놀{뭋U\$$|[E"]fUWVSd$utGv$PXSۉ:t-C$HKNj:uԀzu΁aŐt&d$[^_]Í'UWVSd$]eE1EE$ ZUĉ$0D$$EU/Et 8Eًuf<u$AY<<Ut< tfTE܋UEȋE)؉ỦD$U܉\$T$ $|VEԃ}EԅuEfT<T @P9UwQ]Ue3uQd$L[^_]Ít&~KŐBōEȋỦE܉UyE\$$`Y[&UWVSÍd$ĉUԉMЋ}<*<@1$-ED$D$$(@DE*MCx]UD$D$$6-M U̾d$<[^_]Ít&{Y态ƁHv$tDPuqMUWVSd$E uEԋUeE1Uu 1Ue3d$L[^_]ÍvttӋMԅt UԀ: XE 1]t& Dt tuꍴ&]}UԅUԀ:EhEEv $JEċUԍM؉$؋Uĉ|$jUȉDžUȋE؉- t EEEDE܋UEȉŰE؍U܉T$ U)؉T$D$$FPqJMMf uIM   t t u €uЄtdEԅt]€tQ tL tG tBIM؍ u5IM  t$ t t fuҀufE؉t&[t&< t < t< RuAt&Mȉ{E1q&z z zE&1 EUM؃ME1M؋EȋŨE܉UM:Jv'Ud$$@Ít&UWVSd$ueE1] u!1Ue3d$\[^_]Í҈UtՅt ; #E1 Dtt uuM ;+BEv 4$FEԋMEEMftWUԍM؉|$$t=<EȅuE< t< u6$DEu]E̅$0< tljUt&8ESMIẺ $D$7E̋U< t< EEEAvEU܋E؉UU)‹MMT$M܉D$L$ $BPMU؃Ut&Ȁt4RU< t< t< u ɐt{u8tЍt&t|MЅtu tn{ȀtS< tO< tK< tGBETuv@E t t uҀufEt&zo$U{U$ ?M̉$L$A6E̋@Uā`ҋUH< E`8,U‰U{ { 1{EUEUU؃E܉UEvA< t < t< {u8t1EU1d$UM t%BttmD$L$$ÍUW1VSd$tND$F$ÉǍ6t*D$F$vtt܉Ëd$[^_]ÉÉ UWVS1ۍd$E$EeU1EEBUƒU$EEuăe <'<\<"v=fE܋UEE)UD$U܉t$T$ $.?@0ҸDЉT$t$<$UAU׋Uč4fvEUe3d$\[^_]ÐUĸ[+EE4&uč[4uH\t&Eta'Uč[4t&[Eč4fMu U @\fu u[E]E <EvEE$@EE]t&uč4<'tct_;EԋU؉EE)؉UD$Uԉt$T$ $=Pv}SučDڍ4<'ut&UEĉ\$T$$r>t$<$D$E@<$@Ulj$=UE4f[0EUEԉU؍[t&UEUEܺBt&UWVSÍd$UeE1MEE:Ev $\?E11t&3<`$<$< <<~<\<'<"E:fE܋UEȋE)ỦD$U܍3T$ D$$;PV40D3Tt E$>$$\$+?Ue3d$L[^_]f9Svt&EȋỦE܉Uvt&Uĉ$T$U1t$E$bE}Eĉ$D$i?@ Ud$U E&UWVSd$ąUȉ$D$1"$Eb=$w$\$ >ËEEUȍ8=$DE PU̅UԍD+UЉT$ED$ |$$[EȺUD$[$Ut`D$D$ئ$:$\$;UЉ$=:$5:1d$<[^_]fE1҅t놅(FуEщу@Et5XT$UЉT$$-$Ɖ$u\1UЉEȉ$9$9Eȍd$<[^_]Ívd$<1[^_]Ðt&}ЉT$|$$ES$sFu@fED$ |$D$$uZ1}ԍL9+ttEԅҍ|tf~+?<$";$7$|$;E1EЅ PFE뀍t&Uȉ$ƋUȋEЉT$D$4$eUȉtFDt F;tUȉ$ƋUȉT$|$4$Rt&<$8$8111E"}ЉT$|$$E<$ED$Eп$ƋUavU1҉d$EEEEUd$Et&'Ud$EEEEÍ'UWVSÍ$tUU EUUEEEMeE12<3<$9EEt E8EMt U:EUt E8rEEEEEEEtyE1 E3 E܋UEE)UD$U܍3T$ D$$v5P"403ut&D$D$$5U$\$T$C7U1++EEEU2Ue38$[^_]ÍM#E9ME 38PEt E8~EE8x`4'"vuuUjOEE<3'teta2EԋU؉EE)UD$Uԉ|$T$ $3P[V40D<3'ut&v3t&\t v3E&tD3< t ]1E܋UEE)UĉD$U܍3T$ D$$3PQ403E0vVE܋UEE)UD$U܍3T$ D$$2Pt403Et&v3Et&v3E}t&UEvE܉U3`E $D$ED$|Mq9M|UuT$EUuЉD$$MUЉHEЍpTEUvE܉U3EEUčvE܉U3EExExs$.4EcEz2Ez!$3EExEx$3EU $T$D$M*8MgEtvhM.ME܋UEE)UD$U܉L$T$ &vPEUEԉU؍v<@$1 NjEЉD$E<$\$.E:U$؍UЍvu`EЍpT E $D$ED$|M17M|QUuT$EUuЉD$$E104'Ud$U u]Eu;(t0=\$ɉT$щ$@ L$ lu]u]fE OuE]u칤]y'Ud$EM UE OEEEt&Ud$D$D$$U EUWV1Sd$} ]EeE1;$E:1EЋEEEEω]U:t^U>,Uv@EЋ])M܉]ĉT$M]܉D$\$ $-P1딍&\7Mԅth`EԉU+UEЋ])M܉]ĉT$M]܉D$\$ $l-P@W<8D`[}}t'"-OUЋEQ$UMD9{t (=]}؀<;tq8(1ɍU؋E$}؋E<8tHm}jET&@v];muUe3d$\[^_]Ít&<81Et&EUĉE܉Ut&EUĉE܉U1OUЋE<U؋ED$ D$O$0t&UWVSÍd$UeE1MEE)vM13$'.E̋U}܃Uč3\[M9D$Eȉ$ug)E̋U)MUЉD$Mԍ3|$ D$$*PV40D3pE1EM1Ue3d$L[^_]Ív(|3tvXUą+t$D$$<]D,t&EЋUԉE܉Uvt&ygM1hUE2Ut$$D$8/UWVSÍd$EE:UeE14;4$[,UEE1UЅt)\t ;Ѕu׋utR 5D$D$$)$\$D$++׳1EU:Ue3d$\[^_]Ðt&<$}`^<$'"}yUĉf{&vNE܋UEE)UD$U܍;T$ D$$'(Pt<81;1;f|;{=E;mt&m;Rf|;(EUЉ}ЉD$T$$EЍxD%vE܋UEE)UD$U܍;T$ D$$G'PQe<8;&EUE܉U1;uEEސt&><'t^tZ$fvnEԋU؉EE)UD$Uԉ\$T$ $&PvBW<8D><'ut&u;&pEUEԉU؍\t&U$؍UЍ}EЍxDt&U|$$D$U1:EUE܉U;b +'UW1VS1ۍd$UeE1EEt&\`My#ME܋UEȋE)ȉỦD$U܍T$ D$$%PMă7Q DtUe3Ud$L[^_]Ðt&M"MvBE܋UEȋE)ȉỦD$U܍T$ D$$$PMăuVI1t&`t3$tN"IfcvIvIIv 1D{t (IM؀8(tVU؉$*M؃O&EȋỦE܉UI4t&EȋỦE܉UI1UD$T$4$(UWVSd$EUEԉŰUԉ$EeE1E&EċẺ$&U EЅx111uȅ9}  1Ue3d$\[^_]Ív!v?EčU)T$ D$E]܋uD$$"P'1t&EЉ4$D$ẺD$U)Utg'"uCt&UċE;} @uԍ4>\tREЅt+E:t'"ttMUċE耽뻍t&+UȉU}9} u䍶<81אvVE܋UEE)UD$U܉t$T$ $!Pv*W<8D닐t&]܉u1vnEUE܉UZ& UWVSd$} ]EUEeE1;$UEE#UEt E1EUăE;.1}t"'E EtWvCE܋UEȋE)ỦD$U܍;T$ D$$n P"1|\G}ti1`EQ E܋UEȋE)ỦD$U܍;T$ D$$PW<8D t&` EEu#ET$UM$UM '"tOUt&$GEԅ<>t|;(}؀<;$EЍE؉T$D$}؀<;tsv,vOU#t&E<81MȅtAT$U$ru.Ue3d$\[^_]Ív:fSvEȋỦE܉Upt&EȋỦE܉U1VfEԅu<D;<{}؀<;l| (t#1ɍU؉$*D;<(uƹU؉D$ D$O$$"v'UWVSd$EuEԋUM eE1UMUԅME $E EЃ$1EEu]ԍ;;tzE܋UEU&v8MЍU܉L$T$ \$$ƍ@eEUĉE܉U< t< tŰMŰ]ԍm;;uuE̋UE1!< t< t< u+[<MԉD$ $uE}MEEEEEEEUԉD$ T$\$4$9ÉEu }}Ẻ\$D$4$$E(M$L$IUE$+UẼ9E M9]MʉM}G}=C;E;]UE6tO]&fEЅu< t< t< u'[<t$UԉD$$uv}EMtM}tEUUtu)u!U&Uu@<BEU$mt$\$UMUBEfMD$ $tUЍC҉EU̍]׋]'t&< t< t< u*[<UԉD$$3ulj]̋]~ME}JM9M} U;U 6MT tM M$miU$T$ EEE]׋]&[<tMD$ $fu.]̉׋]EUE UWVSd$EEeE1$MU؍)؃U$1MEEEE9t& >}Uȅ<"UGEĉMME܋UEȋE)ȉỦL$U܉D$T$ $kHUfR >}Ј +Mԍ[9ȉwE >}NMUe3E8E,d$\[^_]Ðt&<\UM1<`‰U[fU[}Ewt&Ut!UtW@UvEЍW\[UvEȋỦE܉UU&<`t<<$tX<"WU}u4t&E!EЍ`[E&WUU<{M}؀9(U؉$UЅ$MMЈT[Et}Ј[QIuU؋}}؀<>t[UԅX$K<(xvQMЋUĉED$D$4$sL=^>EV 'UWVSd$]$EeE1EbM Eą11;t.9} aUe3d$\[^_]Ð\'ƒ"OUĉX;} ~릍&#vCE܋UEE)UD$U܍;T$ D$$PcK19} 71Bt&؍uEEf><'t^tZufv^EԋU؉EE)UD$Uԉ\$T$ $"PW<8D><'u<u냍vvfE܋UEE)UD$U܍;T$ D$$Pv_W<8D&EUEԉU؍t&<81EUE܉U1fEUE܉U~o UWVS$4E|EU txUe M1EE$pEuEEE6uDžlv}<$Ulxt x|1EUUEEDžpp :t&2" <E}EE̋u<t@Ēɿ u9}^UE 2EE̋Uu :suVttu Pu:9|9}U\$$E넍@EWvE̋M<e $TE̋uTGGE&>/wU<$=uVctuPu=&=`/~\uU| u|PULu|ރ@}tх47  E̿A$o'U'@EẺEE +ű}<$p<'tite  EЋUԉEp)UD$UЉ|$T$ $`Pd L Mv<1<'ut&MẺt$ $D$B?}u: Džp9 $}uDžp&DžpM9Eȅpt }ąuF4$9HD$$|EK&EU̍@E̋E$= = Et UMAE̋}<$D$ED$Džt4$a ẺTU<@EPŰU|(WẺfut UMuEQ4$ @UE|D$EĉD$ EȉD$ED$EP=~ = xt Ut @$T1Tu+T119tyf+M9 uƋETE|$T$$9M1T<$ }wu  Ut߅Bu Pu=>tU&~FU"0@1ɉẺEŰE}! Džpt> 4$G 1Ƀpl v}G!uȅUҡ88D‹}D$D$<$~Et;X7X=E̋l)‹}Eu܉}u}܉T$|$ D$$ Ǎ@  $ThM11}]T@ I7;EM̉r}Th8tvR9EmEtu}GPu=.vE=Kv„t}|~|t|UBPo=]t&yf $ +M9uƉ))ËE\$$Et&xR&EMEu M|$L$$ƋE`>E|$4$t 8~ 4$REE~t&EE$.Ue3E2$[^_]Í&4$1|4$D$Lw8$,huuFT<@E}D‰|$D$E$XdEdEDžTd: DžTd<$0E@uEUE$$pN|AMQtHQfy uHV t }H W@tH@]ątHD$$ELX XvmXXU̍E܉D$ l)Ћu܉D$EЋ}D$$E U$STDždEM11T}hv@\29EIƉMw苍dTh 5Tt}}|~u Vzl})‹u܉}}܉u|$ T$D$$Ǎ@u$TTDžh}M11T}d@\2;EIƉMr苍hTd E̋}9E̿`XXU̍E܉D$ l)Ћu܉D$EЋ}D$$Eu$iT\UhE11ɋT}dI\2;M@ΉEr 4$~QHUv<2Zf40E<0JfUEUԋUvEЍ<2.\Eu9މu} uE0L0u0t&9}EXu\$$EX벋E$WtHWfy MHQ t uH V@tH@|HEXXU̍E܉D$ l)Ћu܉D$EЋ}D$$EqMl$TUhE11ɋT}d&I\2;M@ΉEr+ $XXD $XXT $!EUE܉U$TWhE1Džp<0E̋UDžp<űMDžp<1E Pvu܉}E$FTUdu܉}$TDžhElj01ɍE$ED$=E4=)<$%u}<$ȧWt BtEEt(Ext x}t Mu>Mȅt&D$4$ŸT}<$&EE4$謌T؋EUE܉U$THmGډu܉}$T\DžhEC}<$,E$!EM $ u4$E21щ $>$t$UljXBp$%XuZ\}KEuK>~#D$4$a4$a<$~T9X<$hXfM $"u4$<$#D$D$$(}$|$y}<$E$EEEEwP=LAu4$XS1>D$@`D$T+`$Dh{E$|Tǹ ED$ }|$T$$gD$T$59u|gx=v9E| ED$$LǣD$)D$4$8UT \=$D$$H@"=x;$2\5!h<$s5D$D$T$$bT$tU$Yh $KDžTT聒,2d* $v!=fa$ `h<$\$xn9hth$t$D)U$MdD$D$4$%&$D$D$$$\$t$1$uD$D$($i$D$D$($@$DžTt&UWVSd$Uc$UȣƉU%tE$ EPBfNA2uЋ8tKtE=&t& ЅɉtӉʋJAuՋ u=5EEuU1ɉT$U$1E==Et C@g4$לtt$jUԉ$T$jES;ЋJ΁a@$D$C$SC`uԐt&}5]Ը۾0E1tSvC=$օu0u$$Eԍd$\[^_]ÍE4$ECU$Eԉ$%-uЉ4$MԅEԋt$hEE]t 4PEԉ$Et&诀=f$D$$‹4$D$"$Υ$t$$` SCEЉ$Uԉ$ u Tu=$U$襽U$T$6EtU Eǃ}~9}}vt-t<$Eĉ$؋u]}]ËE̅uӋEȉ|$D$E$KủÅuEt$tE '$Ɖ$끍&tE?^t 1E@fE@@SUЋMȉT$ L$|$@$!&e1ۅẺ}ԐUȋMԉT$L$F$uۉF$W ~6uEЋuЃ@}ԃ* ‰$҉T$ỦT$+ËM̉ $n xp$F&tE?,1EȀ$脻FftE ?~1EUЋMȉT$ L$|$@$SUd$҉]u}Ɖu1]u}]Í&M ED$E$$t$}#EE;%$$蝺$\$1U É<$}N~4}}t+1L$]u}]ÍvMԅuՉڋMЋE$yUԉƅuEt$tE 4$}4$Eu댍E;# E[ED$D$4$U܅:?H1tP1@tp$4ƅE MЉD$ډ<$OE܉4$u܅E 4$~,f6HbE MЉD$ډ4$Ɖ<$yE }4$O~E4$dubt&EH4$\#t&UWVSd$ĉEЋEMԃEt :rE1Ҁ;EtMM9tUȉ$UȅA]u $UvËUȋE tut E $_}+tu}-to$$訷$\$<‰$U?UȉƉ$"MЉ $Ƕu[MD$t$ $ܦ4$d$<[^_]Í&01:M=2ED$t$$q룍&UEsvu̅t]u"1v$贶fØÁOt&UE܉$UE] $UjËU[vUWVSÍ$4U}Me M1ɋE UEUpủuЀ|#ruйޥ$bEŰE9H9E2~DMDžtDžxDž|E#Ey?t -%È<}@t$$ È<}VE:PU Lt7t@EDžtDžxDž|E1v}DžtDžxDž|EM#!RB< WE1@EMЈM}uEu(Et}пE<# <@HUtÈ|}U0< gEUE}$MU|$,xM$lX1}pE$βM1tpft M9}bEEU|}x' tQ -  %t+ ##]t&];tMt }?E$]U$RMl}ÉH87sT3DHu _ouй$ѭEŰE9o ?t-t #X@EЋE$$肭$$EE̋UÈ<!Et$$o4$gE&<! ?g#^@U*t&CvDžh~DžtDžxDž|Et&DBЃt$$Sf}<$蕱1<#EMUAM̀| }EE۸hD$D$D$$\$ut }<$#]t E$U$Ue3$[^_]Ív#fdMdIMDxM_ȃ0< ?t #!lExUtEuEMt&Uאt&$ddE}$d蚮d`$WK&EMU$E%@EDžpDžlE$JUM$EUY1&}?t*}#t$}@t1Ҁ}*‰UVпE=t&EM1@E&D<@Et,<*t(ET€}]Tt&ET‹E @EDApu}_uT$$谭T$L$>Ɖ$tD4$GD$D$$lEÈ|*EUD$$tMEtEt MUt ]<$}<$4$UẺMÉt&ŰM$EÈ<}@EqME ]MEȋMD$UEĉ$؉}EMEȋUĉ $|xEE"E11Et&]3}<(<)HD+JE܋UEE)UD$U܉\$T$ $PV]40D3uE]D$$覗ǍE<$D$É։<$ EEM $}t ]$]t }<$É0>~{EqHeu<:uHUu1M vet&vUt&mv1Bft&@p2+]MU$k E}$hUE|$BpHM<*]{}<$AEt E$}t U$M $5 E}@1}*t&}<*t<@u ]1ɀ{t\<}/@<D11M $]ẺÉ4$|$:q` ut vuM $]E̅딋M]M܉]vTd $3dT$$輦T$L$JEEȉD$ED$$dt$dE*x] Md $dK@< w$d諦du$dcd/1t-&ƍF<`t u vufUt M $FE?1ۃ+tIMtEt EUt UM]L$}UE\$<$ËE$EU$f}D$<$uEP@E̋M4E#Ry{LM]M܉]v1]$bE~}1=>}EtEt }}t Eut U$]M]L$}+UE\$<$ËE$UMT$EU4$MƉ $]${$莲d=D$D$Ч$v]$\$$}<$ $d謢dE$dD$ dUET$$yTBE s; 11$]<@lt} E8 D$D$-$]$\$$0}<$%5 E @EE$D$EȉD$諜Ëdt@Du=H 11{E1ɋE0*t@u x] @' UDED$$mUMȅD] 8 D$C$"EO Eȅ8xy 1E"$‰$T$j4…11:t,1zt1zt11փ$T뭡$L$31 t&tB `uЋt @ulj$|$3IÉ$\$3#$Ck PD@ D$Z@$蚻3 d;[{ 1I`v|*|9yP EE11Ʌy]u9u5t} }M1||щ $'|$|$D$$#x<$EU:x $T$JxEU<$f}^} tX]Mu9M |}9}v EUEUUtp ttvXUȉ]UEEQUM9Eyt Eyt1уMu1ۍ}FfEԋU؉EE)؉UD$E؉|$ D$$Pv4SDڍvM]Uw[׋UMUԉM؍[ƋM EċU@@MT$L$UMt$T$ L$\$@$"}9u+1E$XbƉ$nxEtʅ]¸t&t @9uօt9 t э@9}]\$t$d`$~hd`9ʉtE$(fu|+u}R&EԋU؉EE)؉UD$E؉|$ D$$Pv,SDڋMvt$t w[ߋUMUԉM؍[Ή\$}|<$\$:ËtuEȅt$EuWk1fE[MT$L$UMt$T$ L$\$@$s$^ۉE\$D$Eȉ$9VxA@fI1A‰EU}} 1Ґt&ʍJ<`t u t RuJȉ ډMEuEU111}щ $U$T$$D$$v$NÉ4$z<$bf,;{tM1{11փEEKk{1^|uMU1UOEWUM1~D$$É$MD$ED$$N#4${$cM $h3x111ZU`T$$lҋ`C1 uKMUMT$ $AƋEȀ8@E$UẺ۴É0}ȅk?b14$1菿$2[ljD$T$ $zE/D$D$-$肿]$\$$+}tEt ]}}`$̻$t$ƉE19]@vb1}q D$D$@$&y|O|?@%EE1EAE$1YEȃHMX@$=EȈ1эAlj$1qY;{{ 1{d11փMx@@t#A‰EUdCp{G ۃ,uPhDžtDžxDž|EUD$mT$$N蓾s^t $XEED$D$$|$T$~Eȃ$EM}]\$t$$`tY1L'UWVSӍ$tU UEeU1ҋ;MEMEME}>H߀Z}tBE}U@EtOu_tt&}9$E$@UEE}t&$8Aщ$L$Hv1t&ЍP `t u t t&@u‰$T$~&}̉E>Et}̉;輯UMP]e3d $[^_]Ðt&$L$뚐t&Eȉ}D$D$4$KNjEȅEt ?(LEULM<$L$zf1t$E%EtE<$E}̋UL>EE[;uEEEuKE 'E !<$P‰$UUU:Eɉ$MlEE<$N}>f}̉E>Eht&ȋ 9t Eu $V}̉E>E$$L$fc:UDžt EEt EU<$T$XE<$}>EvEȉ}ȉD$4$ NjEȅED$<$| $MED$EU<$M $}ċEUs5 T"vMEL$MD$ $ŰM==$t @YỦ=Hc4$觹4$O Ht wmẼD$D$4$.vUt U=Huz}>EEt&Mf4$D$|$0.8]$腶5HEEEE$EE$蔸 ɺEyf:zut MM wE$E^&4$$%$t$蹸MEt M}E&$T$t&t =E<$D$JUEEt u UE$XP@D(D$D$$oEEU:t EM $RE4$詴}E $P}̉E>E<$tA}EEW$U艶$螌U$T$/$EdEE8)t]E$ 4$}EE%<$`JE8t E$QEUȅ҉UEE1҉}uE׉]u<)<'<\<"tyUUE])M܉]T$M]܉D$\$ $茲PW<8Dt&9}S><(qE뇍OU膌ҍ>:tljUOUvDE])M܉]T$M]܉D$\$ $PoEUE܉UkEEf><'t^tZկfv^EUԋM)UMD$Mԉ\$L$ $肱Pv/W<8D><'ut&<냋EUEԉU؍oma}u]U$話^E}u]uMD$ $vEM$qM D$Z$IEuEUE܉U=$MEw=He$nMEUUd$]Éu}E؉։ωD$$ $$E$Ɖ\$@$蝳EUD$D$ D$D$$;Eԉ4$`Eԅ5]u}]É$$SX@@t"$D$D$jÅ;t $1ME&E؋U܉$T$n98t ~4$nMÉ4$1肯} p]u}]ÍvE$D$|$ËEt$au;u{u uf1뢍t&11f$pK}$D$Z$1FK] UWVSd$$8Eu{<$VÉ<$葮E$M $؋M10< vJ{u uC1҉$=Ɖ$3d$,[^_]É<$0T냍t&$t븐t&E$M $1M311d$,[^_]ÐUSd$]$軭]d$[]魭'Ud$ء]u}]u1]u}]ÍvtD$D$$3tˋ@0@t\Eހ;.u {/$g$|.@/lj\$@$<$<r<$>.t&4$$4$t$ȯ?D$/4$t.D$ D$t$$ߗh/1щ $1߃щ $躄$\$NC&USd$tVtMD$ED$$øt-Ct$$C$$d$1[]1d$[] Ud$tD$* $`Í&'Ud$ tÐt&$@Ðt&Ud$؉]ۉu}u }txD$D$<$Ë@t^$ {4$A$V$t$}SЃB>/tJEC]u}]Ív<$$$|$虭C$ljCw>U1UtB] U1SMtiؓI1؄u[]Ð&U11S] t&i“[ 1„uE @![]Ðt&UWVSd$ԋ}u t;Gt4G~-E9E}-Mu t&t$օyd$,[^_]ËGE;Ev'USd$]$[]d$[]M'UWVSd$ԋ]ۋ} EHP~xEt&UЉUUu#@C$׋C$ݨ$ըt3uًC$辨ԍt&UEEEU9PE@d$,[^_]Ð&UVSd$]$ Ȁۉt:$賀ۉ^F~1ҐR9|d$[^]$@wF@Ft&Ud$ȉuu ]}u1ۉ؋u]}]Ë~tE1E1}t.UE&iϓ@1τuF!Et1҉u܉t&9{ uCU8uU$T$Gt ޅu]u܅t nIU&UWVSd$ԋ} EEE11t#ʍt&iޓ@1ބuW!tHtAUt29s uC8uU$T$M脮MuԃCUEu1ۍd$,[^_]ÐU$~ËU܋s C C EGCd$,[^_]ËW롍&Ud$uu }]}Et|11҄t'&iӓI1ӄuV!U$ ~UX @@xF ]u}]Ðt&D$t$<$<h]u}]Í&$;'UWVSd$ċuE/UB$vMEԋYEEԋMUEU܋UE؋41i$|É~<$ͦ$|$|$v~C1t M t;<$U CF C F6CtB߅u$|E두<$`$u|$|$ 몍&E؋M܋UEME9A UMԋBAEԍd$<[^_]ÐU ɉS~71fR9@ @@@@u[]Ð&UVSd$ ~:1ۍt&4$FFt$74$[,9 ̡t$ d$[^]Í&USd$UT$$wKt3@ @@@@d$t[]ÐU؋MȋPUP UĉPHHd$t[]Ðt&UWVS$d$nEt%$x$zU$T$E 1f[9 <0>tۋ@ 4$EED$~JEUU;U8@E|D$t$$Qi8PtPxUT$$Ix;Eo8}8P@ 9|D$D$$|Ut&UE u48x|$U@PUЉP @H |U8xT$$IX}NP;}?؍[MD$D$$aD$t$$ 9 UED$D$$gU$ϟ$[^_]Ívt;U&8P@ 91Ƀ}t|D$$該$pCp$E /f]&jv$LT$[^_]Ã}xT+v$ D$賥 ,D$D$$Ԟ|'UWVS$dU$舀5 E=1ۈ| f[94|8uދM$L$xxuЅۉxgED$Ex$Fxu$MUȉPUЉP UPHHUމ$袝$[^_]Ít&֍F <$D$GuǍ |$uËUE1t%U$|$uM$L$"C|CDB BBBB$[^_]Ë=7t&USd$4$ $tf@l/var@/mai@ /4D$C $n؍d$[]Ðt&UWV}Sd$E$>htvf|$4$|ty1ɄuSv1ɃtItBu\t)%t?u8tPc$ۛ롐u1$9Hht1-d$,[^_]t1҉$舛ٍUd$ tÐt&fUd$$}ÍUd$$ϕ]ugtKU$T$Dt8]x1$-UM։ θt+9|~1]u]Ít&9vꐐUE уBu P D]Ív'UE]$ UE] Í&'UE] Í&'UE] @Í&'UE] Ðt&UE] Í&'USd$]$D$+$ d$[]ÍvUd$(u'@u$uOu.D$pl $R+D$$<+fD$o $$+fD$P $ +Ív'Ud$,#(#$# ",($ ? f! " ? @AuD$$P*$ D$$;*=$ d D$d$ *D$$)=(D$($)D$$)=tZ,ң,uD$$) D$$j)= t3\\á,롡d(H\ȍt&Ud$ t "tt=? t$Í&'UVSd$ t!>  t1 "t&< "tV$֍[At uިu[Aupu%$%, tu%(d$[^]ÐD$$0(띍&'U C d$.&'U> d$&'USÍd$ t; " t;ȃ࿉ t  d$[]f؉Uf UfA ōUSd$]$D$B'1Y$ d$[]Ív'USd$]Atu< @t@~= Bd$[]t&CtBt@Đt<? uD$$&D$$&<u  vt&d$[]ÐD$$P&et&'USd$]AtuTC u  " t  d$[]ÍvCtBt@~9 uܨtبtv1҉$ vCw뀐t&<? uD$$s%D$$`%<u  끍v$D$-%r&Ud$$? %dÐt&U卤$(TL‹ ]ut@u "? Ptt1]u]Í $1ۉ $jP$t$脕KuC:u։t$$ruƉ]d$[^]ow&d$[^]UVSd$ۋuu+t&=0` tYS$Љ$)wt_Cuхt܋C:u҉t$$~u‰]d$[^]vt&CK SL$T$$x딐t&d$[^]Ð&Ud$E E5UU!<<(uɐUe3d$<[^_]f<[tlz<@t΍+nsv@E܋UEȋE)ỦD$U܉t$T$ $oPv_1҅HE֍^F?&-t&<\t<]uP<p;t[cvEȋỦE܉Uf1tt&UWVSd$ԋ=\uu d$,[^_]Ë1ۺtv@ uP$ E^1t&Uڍ[t'U$_Uu؋$Noڅ[uًMtD1ɅҰu@؉MXuEEd$,[^_]nU1ѐt&U1VSd$=4#D$E$s=$%D$uƉ$nt l%t\u5t4$gd$[^]Ðt&4$l%Knd$[^]Ð4$XU]ÐU卤$]]E \E‰u}E\`$Tj$Fj|$t$$6n]u}]ÍvUd$$D$dfUd$D$pj $EÍ&'USd$ ɋ]sv[`d\D$$Ui$\$sd$[]f$tv YUTu $>衩4Ud$EPv uA  u[h$Etttt tt t9u랍v ttuHuh uyt&Í&'Ud$$#ED$hUd$t&uu`d\fUS1ۍd$tJOʀtvK uD$$ܡD$D$@#$n+x`d\ufu' t tt+$'t$7&d$[]Ð$t&ӮQt$iD$D$$f$iO'Ud$Uu  uÍt&t&UVS$` u$[^]Í&pE$1el [ tË$u㋃$uыD$lEt$$h렐&UWVS$ t$<[^_]Ðt&Dž\pl E`1ۉ4$Gd$9d[ D$4$mu0ۍ\v[ $uߋt$|$$gT ҉utXutt[ D$t$$wgrv $<[^_]Ë|$t$$uzt#E}tU1LD$D$$UUD$D$$TUfUSd$á;}:-t؍d$[]Ðt&zauzu@1ۅ! USd$á;}:-t؍d$[]Ðt&zouzu@ ϐt&Ud$;}t&Ud$D$$ [t fE ‹t 8[7E\Ev?jUM9 tOD$D$$JS1#v$H MCD$$ PU B8!bxX} M7M UA8vU1xmMt 8]uAxu;}~ED$$ :OD$D$$Q1Ud$Ȁ=uLD$ бD$D$D$رD$ܱD$ D$D$ $4XÍ'USd$D$D$$UQD$D$ &h\$$NED$D$$QD$D$$ND$D$8$PD$D$$ND$D$$PD$$ZND$D$̲$~PD$$.Nd$[]ÐUSd$]C$ P$P]d$[]OfUd$ȡ]u}u1]u}]Í@t$ (ÉơEHɉM~4119|;}}$MtH Ruԅt$dD$D$ p D$$hL^vUSd$EE )u] Md$[]V&d$[]ÐUd$t3$D$ 营$S$Ít&'USd$ud$[]ÍvD$ED$$itԋ@$8C$MN$EN$Y@ Ud$t D$ED$$٦t@1ÍUWVSd$u4$ Px<$ &Eԉ<$&EЋEEEt&UMMM1҉}Ef1[tiu< < v<\<"<'uUȉD$$HHUt[لut&9]}Mԉ $OẺ+EEẺ‰E92M2MMD92Mt&Ǎ9~Eԉ|$$X$EԋUM܋EẺT$L$$JUԋE  M܋Uܣ E؉E< < }]v'tC[<tX< tT< tP$OD$#u9\"u[t<\8t[uڋ]Ћ})؉U‹M܋EЉT$L$Uȉ$IUȋMD$\ $UЅDE؉E؀:Ru@MЉ $-@$EOMËEԉ$BMET9"K2D2Ǎ9~Uԉ|$$"EԋM܋EEL$$M}UD< t < zfE1[[ ~\t8uUKULH%&[`[UȉMUKMċULDHvMԉ $%LEE)؋]ÉE؍S9)K2D2&Ǎ9~Uԉ|$$x!EԋE܋M؉D$EEL$$GUER E܉uR1]1҄Et&E܀8tN]DE|oMĉD$$H1 M됋UЉ$HEԍd$\[^_]ÍvUSd$E$1t"Z$J$ $\$Kd$[]ÍUd$tE$5t @Ít&1Ít&Ud$tÐt&$蜟Ðt&Ud$؋ ɉu}]}u tx<$to@$G4$J$$ $t$J{CC4$ID t uC]u}]Ðt&3$ <$I$$|$FJ4$|I$$t$%JCC4$VID t\ tW<$59I$N$|$I$t$D$辠XE]u}]vC룐UWVSd$u} t,F t%FX 9u [ 9^tE$D$ׅyd$[^_]Í&Ud$U]҉u}M ]u1]u}]Ít&B EtrF 9tًx1߉}81 }t4uuUp11 t @ 9ufUUUp x3Z3J~px u~ u ˉr t%;b Iu^ZJˍv'Ud$E]u}] Mu1]u}]Ít&P t9H|9Xrڋ t 59toPUR 9Ut/z211 tA}Er11 t#R 9u 1pE BY;J|;rpu놋vuV x&UVSd$UM uUM$UMÉH1t4$qF$$t$GCCC ؍d$ [^] Ud$uu}]} MF ɉEFɋX t;L$$D$'SPCB V X UԉV tgF9t"}M䐍t&UMK[ 9uC;5X^Nt@Eԋ]u}]Å_]u}1]ÐFFƍv fUd$D$E D$E$Í'USd$$@@@ D$$D$@ @C؍d$[]ÐUW1VSd$ƋE] 1ҋ1;]tHfCD$ST$$VRB VRPVBVP [ 9]PuF~ Vd$[^_]Í&'UWV1Sd$}tkƋWGFG F GVX 9tDCD$ST$$VRB VRPVBVP [ 9_ud$[^_]Í&UWVSd$ċEEH 9@EE؋@ 9E؉EU 1$1CEЃEԐt&Ext`U<$BE܋EE9}lE|$$Cu܅EU;P t%E D$E$aCuЋUR 9U؉UuMtE0Ed$<[^_]Í9}U\$$Ewv$@@bE2f<$P6E]<$?P$$EEd$<[^_]fUSd$]t!Ct$?]d$[]?t&d$[]É'UVSd$utGVB 9ut&؋X $F9u;5@@ FFF t d$[^]Ð d$[^]Ít&UWVSd$ԋ]ۋM u 1d$,[^_]ÐC ɉE~t;S1B E v@ 9~9u9pωPF B ΍v)0x@ 9uE)EC C@PCSElbt&Z $}ۉuF Q&EMt 8t&ыQ 9uA @@ CCC E$E1&'Ud$D$D$E$ÍUWVSd$ԋ}E EuU$T$t$E܋E;p}dURUZ 9S ׋E11 29fCU܉P BESZ  @ d$,1[^_]ÐUBU܋@P UBU܋@BUBU܉PUBU܉B EUPp@ Eܣ 1d$,[^_]Ít&U;d$,[^_]Ív~V[ 9]tЋCNjM11 tN99Us׍& vU;Pf+t&9M&랍E܉$C$;u1t%U$=$U$T$>CE 1d$,[^_] UWVSd$] t/11vCt$D$ E|$$u؋Ed$[^_]Ít&U1Sd$]t:$\$d$[]Í&Ud$؉uu]}u]u}]fFu1]}u]ËV tX 9tfC$SDžt$d:{[ 9^u랍&USd$]t!$C$~]d$[] :d$[]É'UWVSd$EeU1҅Eu 1Ue3d$\[^_]ÍvX t$(NjEHQ U;M+E}t&ME[ЉU|$$ct~t~t4$';&EċUMB ;AtEċU Eąt4$8MEI 9HMMΉL$MD$ 1Q$T$YUNjBt $ƅ? t t<$w:Ht&tt>to~t~t4$MI:MUč9mt&9}MU\$ $EUEt&11봍t&vuċ}E9 [9}<$\$EljE)M m<$É<$I7T;'Ud$ȋM]ɉu}u1ҋ]u}Љ]ËA t@M$1aM1AX 9tIs1t+4$UM 9$$t$9MU[ 9Yu42Ћ]u}]ÐUWVSd$ԋMu1d$,[^_]Ít&y tAX 9t1t&SMT$$ԡƉ$J,$|$.*lj4$6M[ 9Yut7t}d$,[^_]-'Ud$؉}}]uu1]u}]fO tGX 9t1t&C$+$t$)[ 9_u߅ttu]u}]顧Ud$uu]u ]u]ËFu1]u]Ív^ tX 9tfC$=C[ 9^uUd$؉uu]}u]u}]fFu1]}u]Ë~ tX 9tfC$SDžt$4{[ 9^u랍&Ud$؉uu]}u]u}]fFu1]}u]ËV tX 9tfC$5SDžt$4{[ 9^u랍&Ud$؉uu]}u]u}]fFu1]}u]ËN tX 9tfC$SDžt$3{[ 9^u랍&Ud$Eu}]u }u1]u}]Ít&PtX t߉$zEЉ‹@X 9tA}ԉ֍t&Eԉ|$D$C$StẺ$2ẺC[ 9^uʋ] EЉ$E@t}E$ʽ裲t8u} CUD$\$$RẺ$w2E̋UЉẺ$EUЉ$}uED$D$8$뷍vUЉ$$!ÉD$ED$$q$D$ AUd$Eu}]}uu1]u}]Ít&XtH t߉$Eԋ@X 9tMuЉ} t&EЉt$D$ |$C$膿StẺ$T1E̋UԉC[ 9ZuËuЉ Uԉ$*@t}E$"t8u} CED$\$$Ẻ$0E̋UԉẺ$nEEԉ$vUD$D$8$U뷍vEԉ$$yUԉD$D$$q$D$A'Ud$EU ]u}UȋM]ut x}u1]u}]Ðx t9H|UR 9UUt;J|1};:v(UE}Ԑ 9t;O|E;wU}ԋEEEM̉M)]ű}̋Mt*UωUȋMċUf 9| 9v9}uL$MԉL$$} Ã$MEtAD$D$8$E$E9PvtE$ӹ謮t8u }~P GD$|$$bE<$.E댉$zX$ $q뷉<$D$뜐Ud$D$[]]u}$]D$)߉$|$G9~b<]u\$U0$3$\$0[] ۋUtM v1MtM)]u}]Í&$0} tE 0uu]u}1]ÍM1]u}]ËE tŋE 뺍Ud$E]D$E D$Eu$t,$\Ɖ$,tFu]u]Ít&1]u]Ív'Ud$ȍED$ED$E]u] $gu1]u]Í&M*t@u݀y]u׋PDtN@t:@$RƅtE8*uuK\$4$#E4$SE뒋@$$Z($D$ 뤉4$lÉ$BE$+EfUVSd$Ћu 4$ÍFD$E$D$)D3D$$E4$D$D6EU4$f+$^+UEҋUtd$0[^]$ο&'Ud$]Éu}EUЉD$MԍE}D$$ƋEE*udx]tfttVуD@U$T$҉EȉU$-1]u}]Ð@u땐t }ԅP1]u}]Ð@tFUDED$$ ~t~t 4$UԐE]D=t=EUЉ|$$n1?Uttt <$UԐM ERU9pt t4$$t<$U҉UUB$*EpU1Bt $舲Dž>~ t~ t4$H&tt?tott<$MMԍU܍9ut&9}MUԉ\$ $EUMt&11봍t&vMA$貱vMAE;Eu܋U܃9[9}E\$$EU܉E)] :$ڱËU$]t&Ud$ȋE]u}]} UuHu1]u}]ÍvU؉$]EUtك}܉UMډf t@9|;ErUu1U܉ΐt&t @;M~E}U T$*L$$>9tUE؉$z5E*f|;Es띃fFMpf| lωː닍&'UWVSd$}ud$[^_]Ít&_tBG~19}#tvC$%CuGv9ҍd$[^_]1d$[^_]Ív'UWVSd$ԋ}ud$,[^_]Ít&wtWG~19}8t/vC$uStE$c ECu׋Gv9d$,[^_]1d$,[^_]Ðt&UWVSd$ԋ}ud$,[^_]Ít&GtWG~19}8t/vC$StE$ ECu׋Gv9d$,[^_]1d$,[^_]Ðt&UWVSd$ԋ}ud$,[^_]Ít&WtWG~19}8t/vC$5StE$C ECu׋Gv9d$,[^_]1d$,[^_]Ðt&Ud$Et"D$E D$$dt@f1ÍUVSd$ED$E uD$$døt9Ct$ 1t4$ $$t$kC1d$[^]Í&'USd$ED$D$E $.ct(@$ C$ ]d$[] t&d$[]É'Ud$D$E$aÍt&USd$]t!$D$qa]d$[]3avd$[]É'UWVSd$ċEu }ud$<1[^_]ÍHtD$$1eEЋ@~_E9E}JMЋMԋt;t&|$t$C$StẺ$ ẺCuϋUЋBE;E] tlMЉ $E@t`E$̔襉t8u} CED$\$$Ẻ$y E(EЉ$뒋UD$D$8$MЉẺ $nE̍d$<[^_]ËUЉ$$+MЉD$D$ $y$D$It&'UWVSd$ċE} ]uud$<1[^_]ÍvPtD$$cE̋@~quEލv9E}QM̋MЋtBt&Eԉt$D$ |$C$vStEȉ$DEȉCuȋŰBE;Euԉ tkM̉ $@t`E$ t8u} CED$\$$Eȉ$E(Ẻ$ 듋UD$D$8$M̉Eȉ $Eȍd$<[^_]ËỦ$'$kM̉D$D$ $y$D$IUWVSd$E=U1ۉ$Eȉ<$EEȍ$3MȉEEE&ME܋$U؉Eԅ~p@ủE1f$EЉ$UMU܋ $L$W UD$Eԍ[v$9 9]EU܋MM̋$EM9M]]E܉$UEd$L[^_]ËE܉$+EEd$L[^_]É$E UWVSd$EeE11}}EEUȉMEEEEU̍2ȅ:EЅ\~$Eԅ;M$u}"uÈ|(UUE܉D$ EȉT$)؋u܋}D$$6PzSDJfU0UE܉D$ EȉT$)؋u܋}D$$P Ev'"`<$>}ąE;M'}E{UD< [EZf}"t}ԅt }`t[E1[E!È|{E}';Uԍ[EEf[Mt&[E$t&È|(E̍U؍[T$]D$$]؉$&{}u}ąt mf}},<.ޗÈ|}t}jEEZfu܉}[Evu܉}[a< Y< Q<}IfUȉUe3utd$\[^_]Ít&E}5EEUD< < < vuUD< W4t&UWV}S$dE$EeU1EEEMЉE${{t-EЉE̋E$}Yu E&EЃ$JNjMEЉL$D$<$E${E8@t&ue35E$[^_]Í&]ЍMЃE]$}EЉ\$D$E$wUЉE)EUUEE1҉É}DU܋u܋}ẺT$ U$)T$D$dPvdt2E̐t&U<\t<,mt&KwEЍRU5vM܋u܋}ẺL$ {vu܉}E뜍t&<$p]$$$\$Nut&ED$ޗ$}J+E]ED$D$$vEEut$D$$yvEE8U:uE4$D$ƅwEuE Bu -t +]CDBuED$ D$ D$4$dMȉÅɉ7Džx.EDžxE9xwsk}4E+EUE1}]~,Eu10DED}ut -T}~-u9E~0E]DE]}t -7}9E~uE]9]~euuEp)Љ1)ȃ$臕}ËpE;UMɈxt;U}]Ex}1߉Yf}}$EĈE@Eĉv]9]9]t$ 두UMEEEE$,~EME $D$D$sE$Ít&u4$EUԉT$ U)ET$uԋ}؉D$$+P_uƉu&UMUE$,Et$Eu4$D$rE$ۉte$VE4$KUlj$DD$F1҅~] fR9IuUp4$pƉfuu:MVU}$M $t{ڋEwMƉ $$]EЍD$ɉEE$ʑt&uԋu}؉uM $1]$&]$<$1}щ $_U$T$M8 MEĉ\$ L$D$P$XEĉv$ډ$T$9evUMB<.t]MȀ{.1DžxȉE)€8UU)jMDBtƅwEydƅwEQE1EyEEDžx)ju]6uESxU$lM $a61Džxy.{E]{0DEEΉM9EMy0EE11DžxEEȉpD$D$ AD$ $pEʋE)_Ud$ȋ4  ,$ 4  ,]u05 }U= M   0=UM= 5 0u]}4  ,]Í'UWVSd$E9ʋEUM܉Eu!ME؉Ed$\[^_]–$EM9MEuU؋EҍIEEEMMU̍Uȋ24$]̉Eԃ9]~tE䍶M}<z18to& t8u @u9E} [9]܉EE9E̍su }2}9u[E+E؉E$MȋUƉT$E4$D$E4$臕E4$lU$MЍ| $|$EЋEUЉD$$M $.EЉ$cUf{Mԉ $ỦًEƉ$=D}4$0|EЉ|$$EЉt$$UD$U${4$9]}ĉ]/&19u}UЍ$|$CE{@E9uMȋu14$$$t$5$E:UƉ$ E؅uMЉ $F}M҃}TEЍd$\[^_]ËU&'UWVSd$ԋ]$ˊDvZ$Et%sߍ&$x҉vuEd$,1[^_]Í&FD$ D$D$C$^낍USd$EE )u] Md$[]vd$[]ÐU1d$& }TP] UPd$]Í&UMu"f&t#tt\u@uf1]Ít&I1]USd$2n32؍d$[]Í&'Ud$1tÐ&Ud$E\|Ud$t2PuÍvk2xÍvUd$}=X]u]=5$? 22$U~ EɋU<$bE$WUDE$e‰\$|$U܉$D$D$ WD$D$1NU܉L$T$$4ËU܉$t1$.6't&`$p$$7h$]u}]1t&EE8\!M| \EEEmv$t&UWVSd$ԡ\$tt U: =d11Ot&8=<$Ѓ D$ED$*`Dv;5d[ }E`@t8( D$ D$<$D$&rbuv\$E ulU$yd$,[^_]Ív1d$,[^_]Ðt&E<$EQt&/0tM:m/E`$$p$5h$=/뀍+/v/tVM:uL$$Fu /$0ˍv<$x$$|$!Tf.vvL$$2.1&Ud$=`$M~[tf$u8u.t*t# uRft u4u&M&D$ $HÐ tǀ#uÀ tUd$E$/t$2-h$Ít&UVSd$Ћ d$ɋ]uJt@t9 |8tf}U8EuSv8tL8EtFRut&ut Pt;u d$0[^]É$d$0[^]ÍE$D$OtKE uL‰u$t$t=E1녍&]`xBt t$uEUD$ D$D$$cUtE$D$UE$Eu=$h=%[=N$1=%uU:t$EVUE뎉$1&'USd$܋h$ud$$1[]Ðt&$Ntt8tۉ$t]x++h$9} x$tp$\$d\h$l$E$ۖh$迹Ed$$[]Ðt&D$D$A$t$;y$[h$l$뒍v'Ud$ h$ɉ]u]u1]u]f*;h$~E\$D$$t/h$\$$~[h$h$l$뢍8uD$D$A$x $`럋$DD$D$^$$t$\$(USd$*to1҅ɻtfRuZx؉$*t@$)&9؍d$[]Í$)؍d$[]Í&1ۍd$[]Ðt&Ud$d.h$Ð&USd$D$t$D$舷$̴D$$ۖ$ۖ`$N褴t8u d$[]f$t$_((l$d$[]ÍUd$$APd$& ߵ$M賄ÐUd$؉]] ۉu}u~|?[t}t ?{tK1]u}]Í&=t|(uٍDD$)$c뽐|$uDD$}$=u%딍&DD$]$gnv'Ud$$t& oÐU]ÐUE u 1u]Í tI ]U1]É'UWVSd$]$K$`u \tCu/"t"'tItud$[^_]v9u1Րt&'t"t&[;ud$[^_]Í[\If[@u\If눍Ud$E'uʉ$L$Ðt&1ɀ"tL$$ÍvUSd$ t=~1f[$9 d$[]Ív'UWVSÍ@d$ĉUEЋ{u fƍF uF$|tE܅@U܋C>1UЍs}]EfM܋vt3$UutUMԋUvu͉}؋U܋E؋}]5ttn}MܸQt}v ҍpu]ЋME܉$]d$<[^_]Ít&$F,tuԐ$*uUԉ$h4$x{EUB=tt$o&Mԉ $X5tU$҅F$1$U܋BC$m &U d$E1Ð&U1VSd$%Ex&D$E$D$ $uÉ4$tt$d$[^] Up d$E1Ð&Ud$D$E]u$谿É$Ɖ$|]u]UWVSÍd$}   u{@ ut "u~f't1"ttt"1t&1ɍ@t u\t9ut9u\d$[^_]Ðt&ː t뉀 fyD$D$x$$\$D$D$,$$\$t$nt&UWVSd$ċ ɋ].1ҹ؍u4$x|D$EUЉD$$~WUЉE<:ufR<:tUu<:tMD$D$B$$\$-d$<[^_]Í&d$<[^_]f1ɍR؉4$x݉D$E$D$VD$EԉT$ D$$AJEԉ|$D$ $Ld$<1[^_]Í&'UWVSd$}<$|ƋuCv[ t7C9~~) :uމD$$u΍d$[^_]Ðt&d$[^_]Ív'USÍd$졨 D$$EX&D$ T&D$D$$T&$D$zP&X&T&$D$ D$D$$@d$[]É'UWVSd$eE1+ @&91t&R<u;LuTE \$Ct D$^D$$D$ D$4$rt $ D$D$$`踤1tHxE؉D$T&D$ ‰$T$GD$$n趥tHu`4$ID$ D$}$4$)$`1҅tP9t@$nt@UЉT$@$Ft*E;T&tX&T&9T&$`$n`h1Ue3u{d$|[^_]f3D$D$$$_h봋 inT&_ByvUd$t)$($  1ÍvUd$t D$E$ÍvUSd$E ]uN,t$$$$\$$,$&+(tR$tX ,:uىT$\$ $ uʼn$m$育E] d$[]Kd$1[]fǍUWVS1ۍd$ĉEЉ$EEtD$4$EԉËEԉ$$$\$E tU$С tU$Ѕl&}ԅt.x&D$E$$Mԉlj $5E$*<$bEԉ4$D$/$EẺ4$MȋUԍD+Ẻ$EƉ\$$EẺD$E$<$d$<[^_]Ðt&Uԉ$]ivUSd$]t$t$$$\$U  p 1d$[]ÍvUSd$ pu6$P$e$\$ d$[]Ðt&UWVSd$ԋu ]u\<t$$0$$\$$<4$kã8=4<E:tesu fvt:uE|$\$$UUuՉ$=$RE] d$,[^_]&D$E|$$UUyd$,1[^_]fUd$ȉ]]ۉ}u=ptsp, us5 t;5 ug$~$蓮$\$' ]u}]Ívp, 0t5 D$@4$…ttu4$UD$UÄt_ f<@tIRBu $| ]u}]Í&t5&@ D$C$9뮍&t&UWVSd$M ɋut, Y1td$[^_]Ðt&0 t$ 9t$ t$D$4$襲d Åuq$$Ƭ$\$Z 9t$D $We=l%£1&$@$U$\$$Ǎ@$/ \$$ 8*D8[vЅ1b&UWVSd$ċU E҉EU|t9t $Gt$6MT\ $Ǭ1҉P$QQ8o1`tt$tE$LvM9~E$$U$T$}‹=l&|t5x&$lht$4$f${$\$Ld\$;K}XP tXu;t&$XtX$\tËE8~d$<[^_]ÍU$wM $Z$o}$|$$ã|, l&lɣhtx&9$NH@pXt$HDt$ozDt&\zRX9ܨ4[[9ܨXvب2BtBtҡlt) Mԋ} :uD$|$$uب[X0$$E] d$<[^_]Pu1=d}&\1ҋ}t& `lD$D$$?~$)$>$\$Å@T$^$dT$$d^$AD$/$dt`Xl$D$D$ƅR$+$@$\$áT$8Y$md$<[^_]Í$vlD$D$$?~V؋xJcvl$D$D$ &$q1ۍd$<[^_]ÍXf4݀5l[Xt!: u҉D$T$4$bu4$$ۤu Ed$<[^_]h}<$MF?~=<$*#fxn>x1`$ ]=l%t}pX1ɺ $D$|$|5X\5Ht&XlRX : u‰D$T$$ujX\f $D$}䣌<$ $5$|$$D$/ãx$f1؍d$<[^_]ÐX\14x5DfXt{lRX| : uƉD$T$$uVUP$0$EMM b=  \1xá$Gp<D$p$#nTu $@$蔡f.ú.~u$D$3Ɖ$ .t$D$D$$H$d}0$xD$$a£|1у ht1{K@<&Ud$؉]]u}<$<~j5pt ;@EE 9Eu $t ;@D$  $(Px8:uD$$iuo$uc$OuU8~tN$tB@ 0 ,f}'t {(D$` $ƅ=]u}]Í&4  $1<tD$ $8t@t=  u4$1^렍D$/$Љ~D$@ $h_$$<;~$=@w&D$ $pD$ $X4 @ UVSd$u ]it$<`<$1$D $軝$\$Oƣt$754$i\9wt&[59< d< \ft$D$t59[< < ) D$  $Z`XUHh@ 4/f2!$ZD$hátLD$D$$ $T$d$[^]Ív뽍&[)D$ $[v{([D$  4$,13$8~UWVS$D$ $eU1D$D$4$k1uύ>t t t t t#tt>D$ D$$u;D> t! tt& &@uG[Ѐ =+< t&< t"< t< t&t>uufvR< t< t< t< vt<#t&Ӎ[t< 9D$ )׍|$T$$XƄ==W9 R!%tDJD+$$T$ډ=v< < < P ȃ))¡T$$0[=$Ee3$L[^_]=;     I    uҍt& kf'Ud$$轋tTt f$µ蔋۵Dϐ&UWVSd$U ҋ]t=1ۍd$\[^_]Ðt$课1@P  39 $MEۋM1111ۉ}܉M*0EEM:D[;v}1MuύB9M܍[;0v|ω}܅|&$$áD$؉${؃d$\[^_]Ð#= 1=h f볍v )ȍR)‹E܉T$U؉$XE܋UEL$MD$ $UU&$U 1~t&@9uUd$ u ÍvUVSd$] ۋut1ۍd$[^]Ít&t$11҃$;{$ $!$\$赾$ãt$S$袩K:$蒽$觓áu< $T$=t]؃d$[^]Ít&uC{뱐t&Z;{ԍt&$f}듐&Ud$$ `!   p 4 @ Ív'Ud$$x Et E1ÍvUWVS$t]3D$$4$N}FEt$D$$_4$$4$t$ȼED$D$$EE$F:=4$}U$rE$W \3>.u~t~$0D$4$||E$ED$$:EE$4U|/4$޸UE$θ$[^_]D$`4${t$4$D$D$4$耔x&4$D$Wlj4$m \;1$[^_]ÍvD$4$,&E$],@D$E|$ʏ|E/DvuFU$ƷU$谷4$訷$fU$UVtE$tD$<$49Et }Q}r&UWVSd$u }4 @ x$ D2< tN< u@yE;1ۀ?`?f< t<'t<"u,Ey볍&x< t< t t&Et$D$yt  &TG> |Z\$$F؃x <`(=x&'#uw D$t$$Αu4UԋM\$t$<$T$ L$d$\[^_]ËM D$L$$ztD$ <$d$\[^_]Í&?`BUD$T$$#H$v{.v>t&<t& ;t$踴}ߋ E1 <IXD$ D$\$ $艒9}͉]Ћ UЋ}̋E $UD$ D$D$REȋMС U  MkR  t tT$UD$ D$$D$Uġ T$$\+E̋E9E}?E}t Ẻ$蒳E$D$_D$0 <$Uu   w]ЉUЋ}U9UyMD$ $谚^EUЉD$M̋EȉT$D$ |$ $贃7ED$ D$D$|$$胃 t&'USd$܋td$$[]Í&$~ p t < D$D$A $,D$D$@A $ i,D$D$A $4M,D$D$E $@1,D$D$C $S,D$D$pJ $g+D$D$J $w+D$D$A $+D$D$@ $+D$D$ $+D$D$0> $öm+D$D$= $ضQ+D$D$03 $5+D$D$ $+D$D$P= $*D$D$ 9 $.*D$D$< $L*D$D$8 $^*D$D$< $|*D$D$8 $q*D$D$0< $U*D$D$08 $9*D$D$; $ܷ*D$D$7 $*D$D$9 $ )D$D$7 $)D$D$@7 $.)D$D$6 $C)D$D$3 $\u)h D$D$A $]D$D$@A $^}D$D$0> $aD$D$= $EE ED$D$$e= E D$D$$>= cD$$D$D$ ${D$D$P= $/D$D$ 9 $/E~ED$D$$= D$D$8 $~<D$D$< $@ D$D$8 $@D$D$0< $$D$D$08 $$D$D$; $!D$D$7 $!D$D$9 $gxD$D$7 $*\D$D$@7 $g@E ED$D$$`@=0 5D$D$03 $ `!  p  P3 4 @ D$D$2 $vD$D$1 $@D$D$@: $\D$D$@: $*D$D$@: $=p$ k$( n0. 8  < Pd$$[]Ðt&r&D$D$6 $ &D$D$< $;vD$$ <&D$$ =&UWVSd$ԋUu} <"1<'ÃEE Eu>~tz<$K9t<$($XǍ@$kƉ\$$}tD>$d$,[^_]Í&t+D$4$q<$Ku<$Ic&}f$輫D$ЁE}t<\u'v\G>u=$@]D$ $dlt\9t~vufUD$ 4$(lUtqEEut& d$tTEEK&븐;~y$7i\^t&UD$!4$kUtEE'Ud$ء]]ۉu}u} tt ;u:t]} u]u}]Dt&D$4$įu҉4$$Eu ]u}]馪USd$3EE_EE$ _t,8t'$誩$$\$S$苛d$$1[]fUWVSd$ĉEܡh M]E=T$$_ d $9$NƋE܉D$\$D$ D$D$4$q$%8o1ۡ tЋUนҺ4$D$D‰D$ơt$С =EX&T&%h P3d$<[^_]Ðt& $n$mbh$$.$C~$\$רxn1ۀx&Ud$ TɋEU uE1JfE19'Ud$EU EUd$uE u]D$4$ah9Ɖt+$c$x}E] u]]t&]u]Ít&Ud$ȁ=l 3  0  4 ]u}5@ = 8 @ 8tXE UD$E$kU= 5@ 8u]}l 3  ]Í&l  뜍UWVSd$ԋu EEt @  EE1҉fB 1d$[]Ív&;&|ːUd$行x&D$)‰$8 1Ud$D$D$$]u}Ƌ=t$t$膬9ƉÉ=t$t؋u]}]Ív$蠛$q$\$IËu؋}]]Ð&USd$t t$D$t$D$$蛖 D$D$$ޫ; t$t t$Ęt $ D$蟟d$[]%t&Ud$؉]u}ƋT&=X& 4$u9tQ;X&} T&< u]u}]Ð< tD$$]u}]ÍvX&]u}T&]É'Ud$表 ]u)t+$IƉ$їt&]u1]f]u]Ít&Ud$表 $It1Í&CÍUd$ t1ɍvÍ&ÍUd$E ]D$EuT&5X&$¸u u&T&D$ $l1]u]X&)ЍUWVSd$ԡ $HƉ$耖X&T&E4$[5 4$荘$n$t$6D$$t<$4$#lj4$腷<$;]tP;X&} T&< u d$,1[^_]f< tD$$hd$,1[^_]Ðt&X&T&d$,1[^_]ÍvKd$,[^_]Ðt&$mVfU# d$UuD$D$$ 5ÍvD$$@ Ȑt&UWVSd$EeE1}EX&5T&U}v 0 tt$$6 0 tt$$~t|ՑfE1&C9}HËE܋UEЋE)؉UԉD$ ؉|$ D$$_PvWt]9|uȅ^m T&1Ue3d$<[^_]Í&EЋUԉE܉UCWt&vv{E1 C9}HËE܋UEЋE)؉UԉD$ ؉|$ D$$蒒Pvt]9|uȅ@EЋUԉE܉UC듍v݉5T&1)E D$E؉$kt&'UWVSd$EeE1}E X&T&M9|v<\p<"ՏfEԍU)؉T$ D$ ؋u܋}D$$}PqSDڍ X& 9} tj<'R[D$ \$D$$o1;X&f[D$ \$D$l$o̐t&[`ωf9^t&9}! 1…t tK9; 2)m T&1Ue3-d$<[^_]f't{\:";E܋UEȋE)ỦD$ U܉D$T$ $ߏP;V40D=X&t&vD$ t$D$ $In1;5X&vD$ t$D$l $nΐt&v듍vsE܉D$ Eԋu)؋}D$ $D$PSDu܉}[f vnE܋UEȋE)ỦD$ U܉D$T$ $賎PvIV40DvEȋỦE܉Uvt&[wvu܉}[aEȋỦE܉Uv T&ӕ1=T&1E D$E؉$QUSd$EU xFT&T$$|T&9t D$$ww=Du T&P&d$1[]Ív؉Ed$[] t&'USd$EU xFT&T$$\T&9t D$$w=DT&uP&d$1[]Ð؉Ed$[](U11Uu‹ u]U1Ut t&@u]Ðt&US]E tыu[]ÐUSE M]x&t< tD[]Í uyD[]f uՃyꍶUd$E UU E&UWVSd$ċMɋ}t E88EE<$ڎU\$du*t&<9G;u t@\w)ύG9|&9} $Uԉ\$cU뜍t&Ut5ƋE)΅E9}9E41MԉD$4$ԎEMwdd$<[^_]f9} $\$ncfw;u Wt ։Ivw>EExEEx$耍EEt&EMԉ$肰MuUD$\$(M EMԉ$$E$E9؋M|9} $\$bU܍41MԉT$4$词E؋U$E蜊EЋMv'USd$E Mt9Hu%t&P @9tXud$1[]Í$x$bE] d$[]UWV1S1ۍd$U E$Eԋ}EUȉ}ЉE"<$EEE11Et&}ω}EE܅t}؅tt}E:tA~9~EI2뼍t&[9}$M\$2a‹EMEfE؉|$}D$<$UMUMufE̅t,E9#}t&;9}$M\$`‹M}tv2vu}ظEE1}E&t2Ѝd$L[^_]ËUԉ$Ҋ$`}ԉE} d$L[^_]qUd$؉]}]} )uC$`}\$|$$h]u}]Ðt&UWVSd$ԋ} uUtE1v:tA[߅t-tUD$ t$$DUu*[߅uӃt&D$4$U虏Uud$,[^_]Í&UWVSd$ԋ} uUtG_f:tI߅[t.tUD$ t$$Uu1߅[uҍd$,[^_]fD$4$UUuGd$,[^_]ÐUWVSd$u] 1҉u3@t"t\@t"t xDǃuލx<$^"Pȅu="Bd$[^_]Í\t"u\RRtȅtă uׅ\BnB"B B"Rt$i^"P Ud$$t8u'E$`Rt8u(t8umfUd$؉]]ۉu}ty;tt$t#tCPtgt8uqE $]Ɖ\$$EUtEU ]u}]Í&M1tE֍t&u땍D$\$$9Éq$ Í@$]Ɖ|$$诇EnE]u}]Àx%UWVSd$]+E u$\NjE 19ÉEE~ @9È ER+] ]ԉt? u]|$D$$Et/UEԉd$L[^_]Ív?]t Ed$L[^_]Ít&EED$<$UƅҸmE9Ut$\$T$ D$D$$b4$ZXt&UԍET$<$D$É<$0u߅\UEd$L[^_]UVSd$5~E81f  [9~"Xuu$[9ލd$[^]É\$$Et΋߉롍Ud$(8D$$1$KD$$$/D$$τ$D$$賄$&D$$藄$1D$${Í&t(mD, USd$(] t$dtP$蘃$Y$\$A($t8ud$[]vd$1[]Í&$dY(뾍v'USd$$lM$XM8$DMT$&0Mp$1M$XMt:8t5t$\$蔂$X$\$=$cLtI8tD t$$H$]X$\$ t:u d$[]ÍD$$d$[]Ðt&$8D$$R}$8D$$"t&$8D$$t&$8zD$$et&$g8^D$$蒁I'Ud$ȉ]]u}{u ;TtHCD$$|-$t$}4$$U$t$X$8nD$$1ۅÅ[؋u]}]Í&{E$t 8$D$$vu6<$>v$SL$|$v$[^_]Í&<$<upD$ߗE$D$}q1E<fUED$pډ$tl$-sltC$lu)<l$rlv$rE<K<t $PuQ<($3t$[^_]á<$Nr<1X'UVSÍd$D$$t @t8u'$7t$LJ$\$td$[^]Íd$‰[^]U@d$E{t&'U$d$E[t&'Ud$D$$u}]uIt 1@u4$.Ttbf1һ1U4$TUu%4$mt]u}]Ít&W$ҍ&4$0tTu $t'$Ot4$_$pZf؋u]}]Ð=q,D$ED$ T$4$EH4$r$H$t$*s$t&Ud$E$U1WVUStDt&Bu/z Zw1J6 u@"t1Ʌu[^_]1t&UVSd$E$cTtHD$$~c$$*~$4$6tt$$d$ 1[^]f$ E$Ed$ [^]Ív'Ud$D$ D$D$ $@fH ÍUWVSø d$ă UQOD$D$$tD$D$$tE@D$ D$D$ 4$eH lj$cۉ5@D$ t$D$$EEeH UMԃ҉H Uu~ ~ Mԃ(H 8} tx ~s}~j1B u\d$<[^_]ÍD$ t$D$$EdU܋ 8H Mt4$D$D$ssd$<1[^_]É5@D$ t$D$$6dH 롍vD$ D$$s9D$D$$l$jlUd$ȉ]]u}u CC]tx us{9‰$T$ljFU4$hUD$T$$Nl}]u}]kt&C< Tt C$ǡTt u CUPFC<$ C1$m$C$\$:nv]u}]ÍvC1K"@ C1t&D$D$U$jU$T$zkt&D$D$4ƍD$KgD$D$\$j$\$!kDt&D$D$kvD$D$ʺSv"fD$D$$1jvC‰$T$\ljvCPU PUWVSÍ$eE1sCSC EFU L = v(DžUe3e[^_]$4tC $跜$ً$$MDžx\C 9@ $FCT‰D$T$C$ 24@@'  D$D$$GnC (( D$D$$mit&@ED$D$$sc |k BYD$$$y$5$h D$S$qfM B$h։߉ËT$ D$\$$,j$m+ 6>F$9h9t$ D$l뇍&Tt $ Tҋt Pdt5 y q h _ V M S $D$D$@Dž $ $d{CtO9 D$D$$j t&$2m C 9t$D$.e   ~+t#D$D$$jt&9tFv $#< D$$d_t&St&Sv$ $f$轖Dž$袉$Dd4t&ED$D$$_O $QfE$ds E$CbCt$D$ D$$htM9D$D$$5hl f$CP9t:$D$by$$Ve5vT$$@C9$Džf $a+vD$$bvB6fB Bt& $b‰D$L$$^9DЋ$dE$bE$`DDžv$cDžD$ D$$f$[l$'`$ZMt&Dt \ T $D$T$\}[8 ‹& $࿉D$D$Y\ t&E$^[ %j$|b&D$D$$d&D$D$$d4 T&$J8-u x1$6%6C,C$S@D$D$ D$ $T$7]q QAAA C $ D$$vD$ D$$c%&$$ޔD$$o$$ޔ9ɣ9Džyt*Džyt $(^t&L$D$$Z9Bɋt $[9ҸD#vU‰D$T$C$%t @@$_$^Džt&D$D$$)at&D$D$$af;‰D$T$C$K$D@@`21Džh$(^vT$$'fVt&v $YDž hW$U}$8Z$k^SE؉D$$Bt#U؉Љ9U܉@nv @D$ D$D$$BPDЋ$OZ$HS@D$ D$D$ $OD$D$$VDžd$T$T$D$A$A$.Z)čt$2A4$D$ZqO@D$ D$D$$N!$^WDž)C$t @Džt&E$wYE$V$Z$Z@D$ D$D$$MA@D$ D$D$$M@Z$8UЉ$T$P?EЅpL$D$$Stm $ D$D$#SQ8t z $zUDžEE%=tڋ $D$D$RT$D$$)[uI %=t7E%=t(T$ L$p $T$8$|XPt&'UVSd$u t*t$KztR]1u,&tqtD$E$nEd$ [^]ÐUE]Ðt&USd$]$Sd$[]Í&'UEU t0 t@ ]ÐUEU tMu !P]Ðt& P]Ív$u]Í'UWVSd$䡀utU1ۍ[<݀u$~E81f Հ R9u PF 1d$[^_]$11ҋ8ѐUWVSd$ԡܨ$y5ܨ~Vب11ɋ8EBtBt[IR9uEUXB 1d$,[^_]11ۋ8ڐUWVSd$ԡܨ$5ܨ~Vب11ɋ8EBtBu[IR9uEUXB 1d$,[^_]11ۋ8ڐUWVSd$ԡܨ$y5ܨE~U]ب11ҋ;XtIR@9u]U1JS d$,[^_]ËU11ɋ:ԍUWVSd$ĉE҅1ۅv[<uE؍C$ۉE~O]1אUv$UR$ )Uԉ$T$S;u|]UZUE܋UPd$<[^_]Í&E@d$<[^_]$EE몍'Ud$E1Ð&Ud$E1Ð&Ud$E1Ð&Ud$EÐt&UWVSd$ԅ҉EUt |ؘ$Mؘƃ t}Ht9P u݋yU܉<$wQ$'$|$ RU܄t/ tS tN tIv tC t> t9uN>NpEpd$,1[^_]ÉǍt&tN>NɐUd$Et&'U1҉d$E&'Ud$Et&'Ud$$]u]@$@ sF1 ]u]Ít&'UWVSd$ԋEE$E$UE܋r}E1 &E41t*4$MO$%$t$XPu܋U؋[9]:E]CE܍d$,[^_]Ít&Ed$,[^_]t&E܋0$3O$H%$\$OU܉B@E܍d$,[^_]Ë]11 x'Ud$$]u]T/$Fs 1]u]Í&'Ud$$]u]$3Fs 1]u]Í&'Ud$$]uu}‰1t$CC^01]u]ÍvUd$؉]u}uXM$ZÉ8@<$^C1 ]u}] UWVSd$Q1ۅv[uE؍C$ۉEE1]܋E䐍t&U 1t3$UЉMM$#$\$M]MԋUЋ]v;u܉ |]܋UEEUXXBd$<[^_]ÍE@d$<1[^_]$EEE랋U뗍&Ud$$M$A$5$)$$#Et `Í&'UWVSӍd$ċ} eU1҉MD$D$$ZEׅt }nD$ u؉$t$D$&D$$Vt }P D$ ‰t$$T$D$$t }t&D$ ‰t$$T$観D$$t2}t,H`Ee3d$<[^_]Ðt&u$PtPUD$T$$z#`ED$ t$$T$D$$##`H&H&H&$ +jv$ ?RLfUWVSӍd$ԉ$jD$D$;F$;D$$];E$ D$D$@;UÉU~F&@9}16u$mCD$$:d$,[^_]fFtΉ$:Ѝ&$mCR$mC$D$:Ɖ$gC$D$:Ék&'Ud$]] ۉuuuyHt$8Fi @t78 t.x&4$T$УH] E]u]ne4$0H$E$t$HHfH뷉'UWVSd$ċuQG~<] pM U u%n&&t&t t\uRufM M؋U x7uGfED$EE$:}t U: }M $76FmD‰$$E9}ǍG9|f[@9}M\$ $ErW $Ɖ<$G FFu]D$4$.Q8$[x$]4$6$z?$MEM< u^f[ٍ4< t)t%<\u1| Ãٍ4< uݍxMpL$\$<$葭pErBN9o2M x@B< 0]UJp<$5pMT$ $pE$]K Et }<$M\}t E$K5ut U| t9uF$t+}D$E|$$K9Et M]]C@S}T$D$<$EUE@|MA@/E$[^_]Ð[< [< N$L$pBtUt$J4M $?4AUB|@ UFE$E$[^_]ÉxIbDžtEEDž|uVCbt&uVG DžtDž|D@ U}Ɖ<$D$RE4$$E$[^_]É$PxۉP ]|tC L]$GEE$[^_]D$D$`$2$\$39_UDžtDž|B $Wx$KYU$P2$$1D$D$D$D$ D$L$$e$@E$XU$5$MÉ $}L8ExtExtǃ1уM}0ExE։]B:ts}uB}1ۋ?|t)щp $r $\$4pM|M렉<$0bETM]x}{pE$Wpt$0U\$$E$Mt$L$$p(7p 1Eu&Ud$$]u}Ӊϋuu]u}1]ÍM9ttE$EU$¡$EE $D$E$$UM܉$t$D$ |$\$YM܋U $ҋMU $t1Ʌt] t  JE$E]u}]ÐUWV}S1ۍd$EuEE܍UD$ T$EUD$$M E|$UuND$/4$-t PUԀxuE܍UD$ T$EUD$$M S|$Y[!U܅b1ۅt $b.MtUEUt$d$L[^_]ÐE܍UD$ T$EUD$$M Eԉ|$MJ[!xt&EЉt$$-.EcUL1҉tB]ÍUd$LUt tHu ɐÍ&T$$蜃Ív'Ud$Lu1Ít&D$ED$$!t݋@Ð&Ud$$(}@@@ @@@@@ @$ÍUWVSd$u$(Ë~ FCFC1t<$.$$|$}/~C 1t<$.$$|$R/~C1t<$~.$$|$'/~C1t<$S.$h$|$.~C1t<$(.$=$|$.~ C1t<$-$$|$.v$C 1t4$-$$t${.C$d$[^_]Í'USd$]uzC t$;+Ct$,+Ct$+Ct$+Ct$*C t$*C$t$*]d$[]*vd$[]É'Ud$SvUSd$LtFED$T$$肂1t'Ct$ C$`*$X*d$[]ÍUd$Lt$踀LÍUd$LtD$ $谀Í&'Ud$LtÍ$ D$D$ $fU؉$T$[ً]D$D$ $$|$$KD$D$<$D$|$$UD$D$$oU$T$Ud$\u TtÍt&D$D$8$$\\Ðt&USd$܋]1ud$$[]ÐED$D$$$EU~6 \9|9wd1d$$[]f1dt&|wD$D$m$eD$C$D\`XUSd$܋]1ud$$[]ÐED$D$$#EU~6 \9|9w`1d$$[]f1`t&|wD$D$m$D$C$\`XUd$E]u$(uGd%f1҅t:C04$ut5U]u]v4$v]uЉ]ÐUd$$h]u}t @1$ht@u~1$hоtT@tNptGN t@t4$ uEuNTtBEt;F$u }~#t t4$d$,1[^_]Ð$uRM=ty4$d$,[^_]ÍvED$$-*uNjE$tLE14$E"E܍d$,[^_]Í4$ zvE$E=.t:$랍v$ t$xQ4$8 a&'Ud$du]}uuT\9D$4$YtTLtPt" ]u}]Ív1Ít&븐$]u}]f=5d%$~1 DžF8-u x $Vu l=F0ډtCtt$D$$f*f hqjuWt%4$t<$i$D$t$$N{ 4$itډMYMtL$D$$?$$D$D$$$ ,t&$EF}Eߋ0E$UȈED$t$軑ËUȉ$uy$ED$Eԉ$u Tɋ}.EԀ8"$$un1(D$D$}މt&xEƅtD$D$$H4$@|$mU1]É'U]ÐUW1V1Sd$ԋ]D$$t=pt vt+Vt1d$,[^_]Ív뿐뷐믐d%1tЅ\d $$t!<$$$|$:lj|$$` xD$D$$ I@U$TUljT$D$$`D$|$$$輭<$E1 <tGt$C$u}t܋SE$E$9o[ $41l$謔sƋx$GFN0@ F0t$$ (4$E$E$ /bin@:/us@r/bi@ n:/u@sr/s@bin:@/sbif@nD$D$m$4$XvUSd$]t9D$\$$$Ed$[]&$,ِU|]ÍU|]ÐUu=t| t |]Í& |]Í& |] U11VSufIt%ZЀwҍD=~߸[^]Ítt獶Ud$ܨD$ D$بD$$# ÐUSd$EE )u] Md$[]vd$[]É'UWVSd$ԋ5ܨxkMبE1 M s9I>M[ +EuE $D$U8Ut!{9~1ҍd$,[^_]ÍvZtBuM uݨuՐt&Ud$D$E$6$u1Ð@t@Í'Ud$D$E$1҅$tPÍt&Ud$D$E$1҅$tPÍt&USd$x]t$D $| $$\$%xd$[]É'Ud$ȉ}=\u]utkxt$ xD$$ãxtA$ $$\$ ]u}]Ðt&xu뤍t&$IǡD$D$$ t>u D$D$С$\ D$|$\$t$ D$$1VUWVSd$ԋU ҋuEv}u[11 tjt`tE$ `EtċF8<$ $$|$j 6`[ uu}u d$,[^_]Ð$#04$+}t֡u=t| t# |d$,[^_]Ív |d$,[^_]à | Ud$D$D$E D$ E$7Í'USd$t>;t9D$D$$D$\$ D$$$@D$D$ D$$$d$[]ÍvUd$D$mE$1t CÍUSd$D$ D$D$$2 t8t&8t!D$ D$D$$d$[]f1D$D$>$mD$\$ D$$농&'Ud$4D$D$$D$D$$_E D$ ED$D$$LD$D$$Í'Ud$D$E D$ ED$$D$D$$fUWVSd$ċE$K5ؘẼM UЋE U EMȉE؉Ut&x txQMЋtMȅu@u܉EE ]ƅtl{<$tEM:t#;]u܋u܃yud$<[^_]ÍD$L$<$ uɍt&}؅u9}u{M܉M벍vUԅt1ED$C$/ t}؅tˍt&u܍d$<[^_]fE̅tCM:]ỦL$T$$ tAt&tt;D$D$$M$L$d$<[^_]D$D$$U$T$A7t&USd$Eud$[]Ðt&@t,<%t`PЀ v@<+t~"<-tV$fUd$D$D$*$U$T$ÍUd$D$D$f$MU$T$ÍUd$D$D$i$ U$T$NÍUd$D$D$~$U$T$ÍUd$D$D$$U$T$ÍUd$D$D$k$MU$T$ÍUd$EuD$D$$$Lw$Kt&'USd$܋]tyCtj8-tCt7U$T$udCt$d$$[]Í&ސxux-utC뤍&뙍t&d$$[]Ít&$E뢐&UVSd$E]u t @Stv:-tWtKD$$u!Ct2$"1tuT貍$d$[^]Ívǐzuz-utSv덍t&d$[^]$ŒUWV}uSÍ$tUEEEE&D$$?=\%+"M@7v$[^_]Í&$l `뗍&9 uM{vɀ n ^}UKv9 ;M/&  9 M& E f@ M5d%UEEF$$$\$E@}ԅEDJ MЋ}!ȅBMM}fEt Bh$YvME>6Eą DD$D$$U$EvEz1ۋ}6t+|$F$1tF[$6u1$$[^_]Ít&@D$D$8f$@$z$E$6t&E%&$vD$D$v@7$‹HEEE$諔E@(UԅjbD$D$m$]ЅMԅ+E}ĉD$|$$躝$D$GD$$R@Eȋ}̉$UD$|$ D$Z\$EUER}Ex7$UMcEMUD$D$$ݷH€H$E}‹H}Em tÍv$S[u4$E̋}EE|8)}IEȋ}̉$UD$|$REUEDD$D$ȣ$h$$k$ƚ‹H}ЅU[}̉|$D$$‹E}}$‹HmD$D$E8EU$ːUtwzM<$$$|$JNjUD$|$U$ UB% AyA~ AU<$UJ }ȋẺ|$UD$ D$D$$}U}E$$PT$@D$ D$D$$dEȋ}̉$UD$|$覸EUE8UT$$qbU$mNjUD$D$$WUd$ҋEu,D$D$L$$8Ðɺut&U1҉d$E^UWVSd$T]=E $u}ԋ}EEC0>{~t~t4$UD$T$D$U4$T$ &DžtEuԅ5M~+t&T$$sEvEۉ<$kU$ D$1t&bC0>-E}ԉ]E~Vtet&]T[t$LD$UUut&u"Ѕ҉U-}ԉ^fEEE$vEЅ]$ D$CE$WF}ԋ]ߐUW1VSd$],t&D$P$Htc@vEEd$L[^_]Ív$ 뻍v볍v뫍v`%E뛍v듍v닍v5dd%t L@ 3E]܍U܋BD$Eԉ$EUBE5ܨxmب1ɉU1t&19zÍ@9Ru:]+]viӫ1Uȉ$AU1Ʌ҉,ܨ )ЍT $بT$@D$ب=t$-ܨ5بU܋҉U$舓Dvu ‹ܨ E…~_ljƒ11ۃE䐍t&ب0Ht)Hu!tttu6}ttMv[;ܨv|EEd$L[^_]Í&UȉD$D$X$U붋UȉD$D$c$yU딉U$D$ EiE܋M1҅ɉ&Ru$yEEEu3vEVPVPV P VPVPC$Eƍ@$NjED$<$q47uFU܉|$$tk<$sF}ЃFtFE܋UFD$$tE--D$D$ $ND$$D$誜$D$D$$脜$輛$h~t<@t6P9B)1ɍt&D$E܉T$$fD$D$$ M؃EfPPND$E܉$cEܻ~$nD$D$0k$$T$׋E1ۉ$#t&D$$D$$:D$D$$ܚ$&$q^&T$D$$萕EE1ED$D$$kNj4$/D$$_D$$_LD$D$$$5$jmv'USd$T} 0ҁtЋ DЋEH؍d$[]É'Ud$Et&'Ud$D$E]u$P} ҃~Ɖ$]u]Ð&Ud$D$E]u$} ҃ -Ɖ$]u]ÐUTP]ÐUWVSÍd$ $]D$$4^D$$# ^D$$< ^D$$]D$$\]D$$]D$$] uaD$$ %\ uaD$$`\t t uad$[^_]D$$P4] tD$$d$] tx D$$[hvd$[^_]vD$$\&\$$ @[Dt&'U{VSd$ЋEU'${EEE D$E]$0>ED$$#|tV@Ew'Et E$E5dD$ \$D$$uo$z=/t ;A5EEtE0${YEu4+Ed$0[^]ÍE@uE5y 량$t& it&'UWVSd$]u߉ډ<$u-E E<}D$E4$<ډك ခUԈMӉ]̡8PEAD$$#t?EwD$ |$D$$Cuԅ E܋E܅L}E܃8u(t8uE܋M @@:D$D$̦$U $T$EE &vE܅t $WE$yWtEEd$\[^_]ÍvE܋@@ $D$!4$ $W\$$OWE$ D$t 4$m6&1tCz$5$J$\$EԉIEԉ$$Uԉ$T$D$ CD$CD$<$h9E<$mEűMԉlj $W&Ft$?Ft$04$&uҡ|$ D$D$$?t"<$,D8 <$<$D$D$'Zd$\[^_]ÐEȋM1*UȋUȍv@ u Pu0t 1҃=T‹ `$M̉)+M̅pCUȉMEMH@UȋEM\U/'E9E~EUUE_ M̉}ĉ]E]t&;]„OUЅUȋEą4tA TUȋM̍4xD$HD$ $*D$ ǾD$D$ ED$$褾t [M;]HEdf[;]0fxD$D$D$ Ẻ$J0t&U$3SM$ L$5Eȍ43z\L}ąM̈U $Ẻ$UM̈U $UԅUaEԉ$3ËE$&D$:ƋUԋET$D$D$ LD$D$4$ZD$D$'4$2P$EE$ D$DE$D$DD$$LEEL$E$DED$ D$D$$荼? &MMt&1҃EVȉM`$Ű]̅UE$ED$D$$"KEE}蚺$]ƅ۸mD$D$*D$E$t$\$腷E$gUD$D$ $D$$ɼ&D$D$$謽$t.Ft$OFt$@4$6uҸCỦ$踾MM9MeM9MYEUȃ<11E$)E`$EỦE=TkR}E؉Ѓу $ҔƋED$\$EMȉMM@U卤$]Éu}h4$聸4$D$Q<$it$|$$e$蝷;ؘ|C#C$薺|$D$$؋u]}]ft@u@4$D$-xL|$D$$褿ҋu}D؉؋]]Ðt&A'f,D$D$Ԩ$v$t$%D$D$̨$贺 UWVSd$tLE$&0҉0P$_108D$D$pD$D$ $RD$$r0D$q$D$$HvبTt t 8/R`DžT\$D$ũ$`tBt;11vt.[t!T$$袴`<0 uΡ$9Trv5ب>GTǡ$@pBxvبTD\$D$ D$$ 4w5بT\ [8/st&D$D$$D$D$ 8D$D$$萪C[uHӋD$D$$萬D$D$ 8D$D$$(C[uRxvH4$D$`D$pa4$ȯDž8V(&,D$$`D$ a,$rDžTiv1\1GS4$D$D$A`4$5ب;D$D$$$L$T$ T$T$Z$tYD$D$ $تD$$舨$ wt 8b(ܨHSLkHCP@SdDžT1$DTبBD$  dLD$BD$e$L@D$$Ƅd>ƄddD$iܨ?91H9!dI!%tqDE+$9~vvD$$ 9䋕PبBD$  dDD$BD$e$DLD$$Ƅd>dƄdD$ePT9HD1$:8]=;D$$1iD$ D$$赧~vm肬(NXUWVS1ۍd$u茮t&D$4$訮ts@vd$l[^_]Í$l뻍v볍v뫍v 룍v뛍vˀ=`%덐t&@냍vx؋5d%v8t3t.D$D$H$%$mW@tZtNp$ `$u)=X`1 !p$81]DfD$E$t$ D$Et$6\$F$5 yF8D$D$ $$|$T랐t&#.4$12D$$tp$$rOfFn1E=l$5xl$ET$D$$=x$l$uh$x))Уh$7E؉<$D$ٍxM܉ƋU9|9&É9}z)‰$4&9~$$袡$辤 `$st&9xD$D$($ D$<$3$茹ED$D$4$萪UԋEЅ`x1;t @uuԋ}Ѕ9|9)Ǎ4$Xo3Eă:w{fEąt EĀ8UmxM=xT$*|$L$D$ D$9$苠څ[vzU$ 5UbUz7U_U$uEUtsM $D$ EĉD$D$$!U=mUD1҉$DL$e7f??먉$^11sEE$Nm؉EЃډUUW1V1S$]DžD$Ȭ$-tHht#rt6at!t$<[^_]Ð뼐Dž믍t&뤐d%71v;ؘ${vD$D$$SI`$躜`D$$脥$薜$D$`D$膤t%ED$C$t E9Mtm$蕛tjC$薞)D$$utH4$1+gD$$D$D$̨$rz4$1vt&'UW1VS1ۍ$uץDžt&D$̬4$t{@ v6$,[^_]Ðt&$M볍vDž뤍t&Dž딍t&뉐끐v5d%%1^t"D$ D$T$$D$|$$h6trh$DhD$$<$&h|$D$$4$TKF[$[vD$D$$w$迖dtn t&t_C8%u$Иx;ؘ}܋tϋS$Ԝ{@‰$T$W$Ӭ7"2Ëx4$蕒GCK @ C \$$ !$ $$Ӭ t(t.1^$1O$1@$I11USÍd$$辘t"\$D$$FVd$[]Í&D$D$8$ܛv'UWVS$]=T1DžDžfC8-b3bDž?C0<-<%:o`$A`D$$ $$D$`D$ $E;ؘ@&@pD$D$$貞D$4$D$&1$L[^_]Àxu1PlUns -? _pD$4$f,5&4$訙fC0<-RNVKED$4$Ft#u9EC0<%D$D$T$$t$9Lt&C0>0u1ɀ~t4$D$ftvC$3D$D$$赜p&kt <$耘$D$諘$L[^_]1D$)4$7d1$LUVSd$]tpCu8-uAt*Ct$$Mud$ [^]Ðt& d$ [^]Àxuŀx-uuD$D$r$$\렐t&uyUWV}Sd$uvEEEEEEt&D$?4$h@2v貍d$l[^_]Ít&$`%|$$GzE܋U؅lщUUM;EU$Uzo2$訒D$D$$U$\$T$'Pt&`%|$$~}ErlEt&`%|$$g~G}E:f2Ef`%|$$/~thE܋U؃|]~VuWUzf`%|$$}M}E@:ẼA`%E3vw`%D$D$"$豔$\$d$l[^_]Í&d%@@0 >X4$={u4$ku4$蕘EED$4$wE3@@eED$ D$D$$1nuԅt3]1]v9uvUM|$ T$L$$NKyڋ]ẼEEEԉ]-t&EMD$D$ \$D$ $vtMЋ]ԍEU|$ D$T$ $J9urU̅t$U$UUtD8 fpEąe1҉uVUĉ$裔H $Mj‹MEĉL$$U\$D$D$D$ D$UD$D$$製UЉ$0v`%D$D$PD$D$M$$9bX`%D$D$`%D$D$ t4$c MȅE$ShtI-1$̭襊sgMA${Q3EЉ$48@D$D$o$$t$.WUW1VSd$ԋ(~ZE11ۉE/v 0$[5$|$Y9(Ǎv~Et͡ 0$U|Ív$Tߗt$1|9Ét+$4$ˌ$|$d$,[^_]Í$訌$|$̃E$豏Ed$,[^_]Ðt&Ud$UE щ] MEɉu}E~}t]u}]Ít&(ى]ԉΉ1߉ÉM11 ]t&x9Ít&|9w}tlM)щu}u9M| $} <$#$8g$|$̑]u}]Ðt&Љ Ud$E]u}-+ɻU$T$wtaUE t_5(u}ԋ}1lj}̋}1 }x;E)ЃDЅy#v]u}1]Ð@t5(19|܅t( ]u}]Ív۱odu$Z]u}]f1Ƀ롍v;UwafUSӍd$t2D$D$s$vD$$Zd$[]ÍvD$D$]$D$茆d$[]Ðt&UWVSd$]EmEE1fC-+pE4$D$uC8+EUEUE(‰EMЉU3MU3U щEUxU9U |hM9Mv`vNE}A(~#1ۍ [$Ջ;(|(1d$\[^_]ËE̋U+E}D떍xHlt]cthvtspt~-t&evUMU ʉM181҃}'ᐍt&M&M&M&M$Zd$\[^_]Ít&C$軎6d$\[^_]Ë}Ѕt'>(96*} $hnpEED$ D$D$$>$6]Ѕ(‰E҉U]u}R& D$ (+ED$D$$ÇEUE҉Ux~ 8D$ ED$T$$lEE  )ЉL$ D$D$$/$ D$ $~d$\[^_]Ë $$u $uBEtLD$D$$蹆vE D$D$$芆V$t몉$tv (EEE U$XtU( $9tbD$D$$(D$D$$ ǃ1щ $`$\$諊0E;vUVSd$$_$D${${A$\$e{É$rƉ$1d$[^]Í&UWVSd$ċ]EE+1EMЍt&C0-tQ+M]MЉ]ԉ(Ɖ;uҹmDLd$<[^_]ÍxuRx@E?vC$Syd$L[^_]Ë5($&wt( 4E$ EC$3$HZ$\$܄Ë(;$ R$(]ԅd$L1[^_]D$D$$蹁${w=( M̉ƍ\]ȉfEȅẺx L@uEЉDẼEЉ u1EEEt2ỦE$E4$׀1EEĉY R $$T$ (U t]f@t ]Ud$$D$$D$$`;Í&'Ud$tPhPlЋ PÐt&US1ۍd$tЉË1t($ţ  d$[]ÍUd$$]uÉWt#t$$D$e]u]Ðt&t$$D$ G]u]fUd$EPT$$EÍvUd$D$$`E|t&UWVS$ ]eE1菅DžDžxDžDžDžDžlDžDžDžDžtDžpDž&D$ޯ$0W@'v/zuUe3v$[^_]Í&$t&t(D$`%$ft/,(xЉ9щQ`%$_ef `%'&t&`%`%x`%($T$1f,( щPT;T$$ta|y$xyD$D$$|$\$T$$uZ&`%<@T$L$$W5@<pt&lt&t&`%&d%l@p4t tt]ddɸmdtDȅDd4DžLDžhth81ۉ<1ɉ &<RÉ4ށ < uӋ 8$ D$G<\hH8\[/D$Y $D$$@X J?\$$/sH-1$fH[I5;-Dž1$5L<$18u t ~ L&= t $u--$bD$$ X ] \$ $IE$HELEPETEXE\E`EdEhElEpEtExE|EElH$D$9Å1 $Y D$%6f1fG$D$8v:hu<tL<8\sGF$L$=Khf$GҿmE ɣ@ t  X <$Fǡ@ @tV<$r‰<$@$D$H$ɈDtDž@\6$Rik<[`m$nA<4<$T$@T$(t$@x<҉DžDžD$ D$D$$wsk8Dž0vH $@$d8,ʹ;uR< t< t< u <u勅@8(fd48L$D$$%4\$<$n$$$ 6$` F$Tt 88Qm-룍v$PEuԉ$r,$Dwt&<$‰؉$$$ $kD$$1҉*$q8$7D `%D$D$$+m$\$of`%D$D$ƀ= gl1ۅ8$ D$= 0Dž $x= &lP;t&D$D$ D$$i$l4@(@C$R81Ӏ:\$@ËBڋ$$zB$@$S$K $t<$)k$t`,$*B, $BX&@ڋAIpHD$$ \S8$D$D$$MP2lj$fjg8$QjG8$YA/8f$fD$D$$2j$T$\$lc$C$nAC$4n,$@d4$D$L$8$ Ë8$888D$D$$M1u t$$H$󥋍H $D$Jxi $Y D$\dD$L$$ 8$"e(m`f5$d뉾Ud$E$>`¸tÐd%$n@u+D$D$$9h$aD$$ 6eUE8etHu1=D]ÍHt1]f1=D]Ív'UTP]Í'U1d$}-Tt/D$D$$h.$h 1Ív$h<$h 1ÍU1d$$7}- u$-$- 1ÐD$D$/$-\.$-` 1ÍUd$}-t#Ts+TÍ&TQ~h$u}͐Ud$}-E t@=Dt8vt+HÐt&8euuAH1ÍvD$$G t!HáD$*n${먉'UWVS1ۍd$ċu?tUMt$$gd4$cUM3[:u‰uB҉DE$4tXXD$|$$4(PۉPt (t tP<$`Ee3u.d$\[^_]ÐC$81\?e UWVSd$ԡ`}t6tU1t&U:uD$<$4ht v[u܍d$,[^_]Ídupt%}d$,[^_]␉$td$,[^_]Ëh퍴&UWVSd$ԡ`} tjt1v[tL:uD$<$UygUuٍdu7ltTE|$$ҍd$,1[^_]É<$dd$,[^_]ËE$D$ 1u߉<$cЋh1҃}-‰1뻍&'UWVuSd$E}&\$$-$^t$<$l?u֍d$,[^_]Í'USd$Mtd$[]$4tߋPfy׃DuҋX$`$6$\$1at$3$^d$[]UV1Std$$d`1ɅtҍI[u40d$[^]ÍvUd$u-ҹ>D$ED$BL$ $[ÃD$ D$L$҃-T$a[ UWVSd$ċ5`}tqEdE&t&C ty4$ЃEt\9tXs[t>tE$|DEԃtF9uЋM s[uƍt&d$<[^_]Í&‹M fC념M fUWVSd$ċuVcD$4$vct)?uS=h%?Dd$<[^_]fEEF<-E}Ӆ+f[…tw?Zou}B-+UȉD$<$U֐t&[E…u6Ht&Uȉ|$$9}UuEӈUEEE$G`Rv1+$D$v1+$D$Ẻ$MXEt&;Jt$.$Z5Tt{$Xd$<[^_]ÍQd$<1[^_]C<--g{]6udu`]ԋE̅Ev;Jv$),$Za-1먉EED$4$O뎋6D$+$x{D$+$v{1ENUd$ȋE]}u]} EtP$UH!!ʉP ׃t`]u]}]G&$x@P$U>[$S1U܉$T$[EUD$T$$ VH PV ɉVt H V E܉V$U$XE܅]u}]fD$$HtLHtH H Pt&H P$t0E(D$D$$Hlt&UWVSd$} eE1uUtT(F1ۨ@tDA[tDf[tDi[tDr[yDt[tDx[tDc[tDl[Du۸<UĉD$D$$TUċF!@FmD‰$SÉD$ D$D$$T${V1Ue3.d$L[^_]Å TuCD$FD$$mD$D$$TTEԉD$ UĉD$D$$SFUĨD$4$.8vDu[kv@Eat&F1ۨ@tDA[/Df["fD$FD$$lD$D$$'S}fE&7Tt&D$D$$RT&D$FD$$olD$D$$Rf@EafvUĉD$D$$XRU\D$4$,X t&'Ud$D$E$tB@u< t t 1ҁ ‹M T$L$$1Í&É'UWVSd$}u t|C1ۅtdtyt&C[tf t t 1ҁ ‰T$t$$h$Pt<$+Sd$[^_]+C낍&1ٍUW1VSd$]YEEE&D$$Yt[@/vJd$L[^_]$ȴE뿍&뱐E맍&E뗍&d%ME t `EME EEEĉ}/t&4$u-U PEC}ԅ0uD$4$q9tD8+BE4$8>E=UUtD>+M܅"E؋ M$5N $M\$TE$EdEM] $vU$QUMtD>ME L$D$4$OE E DE E t&M!Ht&4$HUt,EvUи1}fE&E$´,E @AE E࿃} @DE E 'u밉'Ud$D$D$E$ÍUd$D$D$E$ÐUWVESd$ԋ]D$D$$lUE UNjMU9t&dUMt$M@` \utxC04$P$&$t$P$}tMUf| [d$,1[^_]Íd$,[^_]f|9$tD$D$$]M1҅tSD$$6Ld$,[^_]ÐUd$؋E]u}$Dd%:dC0T*D$/4$J4$N$$$t$cOƅ$t$$  t9D$$ nD$$BD)>$Am1;4$D$s$؋u]}]Ít&C0D$/4$I4$I؋u]}]Í&4$%=R5 C04$wM$#$t$ N$ $A輰=$#p<$M$&#$|$MljD$$ |$$M $A,&D$D$$fJ$CAC0vvCD$D$$WJ$\$C>C$3Ud$u ;u DtC;t&cvܐUd$ $D$TfUVS1ۍd$u=Pt&D$w4$XPt#ft@d$[^]Ít&[ˍvd%tMu$OuiD$ $ D$$Ld$1[^]D$D$µ$H$ Gd$[^]D$D$ѵ$H$A1Ud$؋E]utUȉ$(@EEd$<[^_]Ðt&t$$UGUJ$;/dE̅Y}\$$D$aM܉Å7t&$VE$?=t&EEd$<[^_]Ðt&D$D$Զ$?D$\$ t$$4=&$ ?1\$D$$D$t$$0Uȉt$T$ D$$;U$CB&$C&$Cp&$VEyCUQ@$D$ t$D$$EV;Uȉ$K=t$D$$(;vD$D$$EA=D$t$$:UD$B4$D$TD$D$$:)D$D$$EDžu1Ed$,[^_]i6Ud$ȋ$=]u~J=t&5]u]ÐA1B]u]f]U\$M$?ËU۸Mx]urEUQ1덐&U卤$h]eE1}<(uEt}0 T$MUD$$UD$ D$@D$i>UMM,T$ D$D$$5M!ȃT$ D$UD$L$|$T$ 4$EKM]L$\$ $T$"]e3u~]u}]Ã=T UM$UD$D$ D$@D$u=MUf$:EɉM $$EU+ `_UOEt$T$$+Eĉ_MtE  I0EMuD$4$t$#}?}B}}EEáEED$E$D$ C<$&w vMt&11ۅ`t @ u퐍t&@u@$̾1`t @ utJҋ @uE$5*Et$\$$R*Eĉ$%df`t[ u$`)t$D$`$ *E't&Euԍt&gfff[))0҈ utc8GD$D$$%UċEUҍUE/Z'E$M:'EUÅt$'Eu)U4#$$$h$hx$$X$t$p]ÍvUU EtP3tR4tuu4u=Ѓ)L1]Ít&1L ]f1L]f@<1t@<2u뚐x0u끍t&R&U1=壈1]Ð&Ud$th1Í@$c.h1Ðt&Ud$T1Ud$E EK'UWVSd$ԉE@t7UL1:t&:uD$E$C*tv[ u۾d$,[^_]ÍvUWVuSd$E}*&yx@D$!t$<$uˍd$,[^_]fUWVSd$@eE1X1ɍ}D}ЉUύ&t$#|Cv[ uىUU1}LA$U։&3[ t>?tUMt$$$4$G#UM3[ :u‰Љƅ@EM$(MtXXL$MD$$wPMۉPt(t tP $j Ee3ud$\[^_]$1`$t&'USd$Mtd$[]F$dtߋPfy׃DuҋX$("$=$\$"t$$d$[]USÍd$D$D$$$\$d$[]Í&UW1VSÍd$u1Rf@DHt@\$$ҋ6t#FyŋF^6u3d$[^_]Ð&Ud$t4ҹ #D$ ED$&L$$Í&ҹ>D$ED$BL$ $ÍvUWV1SÍd$ԅUt{} vt;CxD@DDuҋCM5uʼn4$d$,[^_]ÍCI뗍&@t2ֻD C[ tuC[ u$d$,[^_]Ud$$t$]u t@xU@DуpE$t$]f$t$҉1]t&q$t$]ÐUd$E]u$$D$É1ɋE jƉ$C]u]Ít&UWLV1Sd$$*@E1tEЉT$ FD$BD$$띋F$Gt{tGEd$,[^_]}D$D$$q$؃$D$룍d$,ى؉[^_]ڡ@p߉]DfFv Gۋt9uM&$\$.Ud$]u}8pG;Et9y{ɃW}U@MDzuɍ&9UhM)؈ t&]u}]Ív7)ލC0E0<wAEE]!E ftIv|XЀv] )tt&)dt&\)Tt&)Dt&)4t&w) ) t& )t& )t& )t& )t&ywɃ7vvɃ0hUD$D$,$f$U1\Ud$ȉ$]u}MÉU0}ǍO; wfVM܉T$\$U؉$EU؉D$E$D$MT3T8]u}]Í&%D$M܉$$Mn&Ud$$"]uD$D$E$G$t$\$]u]Í'UVSu d$])$t$\$D$ D$D$L; r\I?$ L$; )T$t$\$D$ D$ $ d$ [^]ÐUSd$eE1EE@$cvN\$@$Ev0\$@D$E$M1ۋBHȋMe3 ud$$[]t&'U11ɉVSd$Ћ5t^F<"te<'tatD$ D$ED$F$щ‹E8u<;"tgd$0[^]Í&щd$0[^]ÍvUM@$xUM럍UM@MUyUd$|&~@Í&=w܃| =s⡜@Ðt&Ud$$]uÉt#t$$D$]u]Ðt&t$$D$|]u]fUSÍd$B;s% J Dd$[]Ðt&RA$T$붍UWVSÍd$ąɉM%u1ɉމ-vD$U|$MMu҉ډ*uBE< w9[Љ}zЉ< w$Ẻfҍ[DBJЀ vẺ.z}ԋE1)I؅ۅ~`1҉]ԉfEv9~?7EEuΡD$7v$9]ԅtPu9t9E Euա$ D$uǡ$>¸u1d$<[^_]Å&E[~< E Euѡ[D$$ 1}[E.ES} *tIzЉ< mҍzЍS[C< w(ẺEАt&Rۍ|CC< vEЉE;}(#t&[rE؉EUWVS$t]t&D$\$vte$[^_]Ít&`%$t"t됡$Ku͡$$[^_]Ðd%EnUBE8E8UuU$&EX}̍GEGL<\<%tWŰEEuU̡D$${}롍$1[^_]fE̋}̃X%u'k$UD$e uD$D$$W Ủ$T$=$r]1ɃUV=ƃEEEE|3t&*ЈU˃0< wPЀ vEEE}.u<*Uc}-E˃0< wt&PЀ vEEE}]ˉ}ĉ}v$_|$ uۉuĉ}GEGE[G7D$D$0$ $t$l== t-$ $8D$E$Y E%E E2$mt P$l Ut7Et05EUD$Ẻ\$ T$$sNME5EỦ\$D$$4mtPt ;$蠬$D$D$ЬÅt2$ UT$U$Ẻy $ UˈUE}mtPtˀ;tƉ$f D$T$$U9UfEơ$ UzUE=EU\$D$ T$4$1ۅPP$ @$E' u} t&ۈFvY<\~E܍[u؀;tӍU܍MEoU E뫡@<"5<'-$E܉MD$ D$D$ ËE܉֋M89" ]1ɋU1ȉE1 EfEE$ MEIU> U\$ T$Ut$T$$@<"<'Ɖ$E܉D$ E܀8>" E}?á$ Mm+U 8UE|$ T$D$$ $ R$$%D$ OEEE6$: ! t U;@=t =)==`t-$$ UET$ Ủ\$D$T$$"EỦ\$D$$wEЉUmd։EËU1E{ EUD$E\$ T$D$4$I$$,WUu U|$T$$EEEU=U\$t$ T$$EỦ\$ D$T$$gb$U$/Eơ$E6}1=;E\$D$4$EEá$su:}8=EUD$T$${V$f''@v Ẻ\$$7U=U|$T$$UE|$T$ D$\$$UET$U\$D$ T$t$$}=EU\$D$ T$4$|WU\$T$ Ut$T$D$$1,E|$ D$\$$ }=U\$t$ T$$ء@$D}=GEU\$ D$T$4$~11@$X11E}=EUD$ ET$D$$:U\$ t$T$D$$=|$$E\$ D$Ut$T$$1}+M]eEUD$$E̋UZx+E$ d }+M1d$뷋Ủ\$T$$&$$=r=E\$D$4$}=E\$D$4$UET$UD$ T$\$$[VE\$D$ ~}=EUD$T$$9=-\$t$$U\$T$ t$$@c$U\$ T$t$$}xEUD$ T$\$$ZU}@m$.$|$\$$\$t$ D$$=t.\$4$=t-E$D$\$t$$rmU\$T$$VQl$=2$v=E11]}+MIUtE]Ít&'UWVSd$ġ;Ene5v٣E\$$VMUVUMt~u:… ʃ҉ ?tBM 1D$D$$D$\$t$ D$$?d$<[^_]Ít&}|Ѝ&x:uát8uL;EM @녍t&Eoȸt&M :-kJr-ztC^t&u8Mm1ۀ9:Í\:Xf@E 0D$D$$D$\$t$ D$$넄ZUd%]ÍvUWVSd$ċM E9+;d%P-Ut+{}-VU]\%@ڃ:h%t~\$ $UGUtg@<:E<;}#nBp5|u`%d$<[^_]È$P Z|u`%?td%d$<[^_]Ë= G9ut9}:GyE<-Et0<+(Ex};$?`%c `%d$<[^_]Í=w0t$D$@U܋$U$?`%-{d%fy`%ft*fvVЀ `%8d% &`% P`%`%d%UWV1SÍd$ĉUMEED$$@5v"d$<[^_]Ít&$M뱐M@&Mߍ&E}E@}Uf5=`%1vvw:uD$<$u׋ EPMDt&M@4t&M$t&Mt&Mt&M &M&M&M&`%`%`%`%`%q`%aE UB FUE@&`% `%tR]Ծ 1t&v t,:uD$$Iuݍ]ԋ UډUD$D$$_UЉ$T$YE؋UEU܉1d$<[^_]$ ?$)$$& <$W$9ofUWVSd$EUM$1EE=WYd%\@Q8t$D$D$,$$ t$D$D$\$$&ËE5CEC1t4$n$$t$5C 1t4$@$U$t$5C1t4$$'$t$5C1t4$$$t$5C1t4$$$t$_5C1t4$$$t$15C 1t4$Z$o$t$C$D$D$D$ |$D$D$褳tPu$E tpuEuvttPu@$$#d$L[^_]1d$L[^_]Ívm$ED$1}E뫍D$ <$ Ɖ$.Eԉ4$胅E]vD$D$ D$D$<$%Ɖ$Eԉ4$;EvUWVSÍd$D$,$w #?[w@w ;W@sf@@7So  3G t2$iƉD$ D$D$$4$Gt2$0ƉD$ D$D$$4$Gt2$ƉD$ D$D$$4$Gt2$辍ƉD$ D$D$$\4$TG$t2$腍ƉD$ D$D$$#4$G t2$LƉD$ D$D$$4$Gt D$ D$D$$;_\$D$$d$1[^_]Í&D$6D$B$lD$:D$B$DD$ID$B$D$RD$B$D$\D$B$@mD$dD$B$wQD$mD$$|5D$pD$$TD$hD$$, D$sD$$D$D$$D$vD$$D$yD$$@D$|D$$dfqD$D$$?UD$#D$$@9D$ D$$D$D$$D$D$$D$ D$$w@D$D$$OD$ɟD$$)D$D$$uD$D$$ YD$D$$=D$D$$!D$D$$aD$7D$$9D$D$$ D$D$$t& t0S  D$$ vD$$&Ud$EP@v'UV1SÍd$uet&K‹|tNC$蹷u݋C0D$D$$D$t$ut&4$Pd$[^]Ð&UV1SÍd$u Tt&tIC$uC0D$D$$$t$ud$[^] UWVSd$EsMUЍ]E$EEEEE=t:M؋5d%U1EЅt$t`!É<$g d$L[^_]Ít&1…uuNjMԅhiÉ<$ 붐t&t\fÍd$L[^_]Í$S$D$NjEЅSrf$΍&1$  d$L[^_]Í&u tcEċUċEBEB1t$$º$\$VUċB 1t$|$葺$\$%UċB1t$K$`$\$UċB1t$$/$\$UċB1t$$$\$UċB1t$$͹$\$aUċB 1t$$蜹$\$0UąB$t`1fEĉD$F$\6Dڅu܉<$x&SbuO1ۅt詶1;fUd$D$$u։]}v D$6D$B$]D$:D$$5D$ID$B$ D$RD$B$D$\D$B$@D$dD$B$;_\$D$$w&]u}]ÍvD$:D$B$DD$ID$$D$RD$$D$\D$$@D$dD$$;_ tVS D$$fD$6D$$D&D$$$ UWVSd$EEEEUD$$=\%-t0EU}Ut0otEDt0d$<[^_]ÍvEU}UuE딐E늍&5`%1[:uD$4$UUuӋE <8%}Ћd%{u1i @e$WEu MD$$D$#E$D$D$ ED$$1׈ED$$Ĉ$s$D$S„J15D$D$<$蔈ED$D$<$}6UF$vtEuUuNNjFD$D$$$\$'듉4$S$SD$D$$$1ۅ ڡ$w$vU1ɉtRߍ@E܉D$ EED$EE؉$D$Eԉ4$2g&UWVS$$EU thteE1t:t$tÉ$h$`Džpl%=5ҋDžDDžlЃD‹Up DppETEP@UE1ہ1H<\v`$h3@ t{tD$D$E$6d|$ED$$6;d. HE.t\UU܃:.^Dždfh]Džpl%yUe3p/e[^_]Ðd$\$$GC1Džl1u^vDžpu/hDžpa9`C$;$tuًC$;fEDždt$E܅t$dt<.t<\6{.HTtMPH|$ЃƒE‰D$h$QXLDPL-@XD$tT$$h81Džd1ۉ*t&dۍD؉Pҍ4tyd4$4udtҋ8\u:$$ut$X$f48 $4= t\\Dl$ DX$x<$tX\$el$pl1҅t$tlvq 4R9wtlgu^t&;$G9u$4v{.`t<.O<\z.v5vC1${;t&\`$7E%= h$vt$4$s4…EHl\CXT$|$$WX$l\&E܃8.E.\Dždh Džpl%h$mƍD$[|l$nDžl1<$&D$<$ D$ptT$$.5D d$D\$<$$\S<$44D$|$$l\z.\1G<.pvt4D$hD$ $f4<X$$D$%_Ux.J.zl&t<$T$!lh$D$l0/l|$D2$|D$l$D$xBl$d$Džl\${1Ix. l1ۉ$c<$1YDžl=l%$2w\fUWVSd$$jÉED$/$UEU1EmUԉ$E8k$] E t E8*@ߗU\$$D$=l%mM DE_}ȉƅd$\[^_]Í&U M Mt EԀ8*MԍD98/REԉT$$UȉE̅E̅}l%^E̋IU ]́U؉]E̻E܉Uĉ]f}Ѕt U:*UU؀9uE8tߗL$MT$U $NjU=l%t ];*]܉M '‹1t]f@ u]E4$UD$ƋUCtы]DA[Iu]E9Dt$}UU܋ ɉUM̋tˍt&$PC[u]̉$;d$\[^_]ËE{*{t&z*]UĀ{+EUxG$5EM|$L$$WE8UEUtv$C[u4$v]ԅtMȅt Eԉ$]t $Y1d$\[^_]Ë]ԉ$"x*#@t`8uMȉD$ $UUuщ]uw$ t&uEMȉ $sMhFE?][U]8+vE9E0.u E EÃ0?*M /MMEa}t_;(@E1E9Ev8t }t;(ti;]3[?*@/cu?u룍t&U9UfRE =MĀy/06E9E}uĉ fv9U MT$L$*$u1$[^_]Ít&\t%DZtr v9fMuY}Nvu/M訸MDp2 "t&EĀx/ &ӼEt&}1ɍCUPE.UiMEMv}N]`Es[] ƷU E護M}_ Ѓ获UDzM dUNM8U mMW U >M&ضU¶M 詶U1E&\E  }t#USUDxt 论E9Eč{ME ɉ]Eȃ[]E҃ME MȉUu[Ut)U:(t!$D$趲u }u5t&MEL$$v[9U}tEt0苵DQtUU;Eu랍}t&][u f<]t<<\t=<[[u :t=t .uԍt&RˍvRÅu;[뱋E9Euߋuĉt&v9]U MT$L$ٸ?<$u1KE#EVugf vɍ^ft&'Ud$ȉ]] ۉu}u}u]u}]Ðt$Դ4$EɴU} E}ډ؋u]]&UWV1Sd$ċ]UM؋U };(1EiF߃vd$<[^_]Ív$\?[]MЋu|U EE̋E9E S;u؉ŨUf[9]9ދMЋEԉCω$MM|$ uϋUM T$ $U؋M܉u1&d$<[^_]Ã*K[MEЉ]ȋu|U E;u؉EG@E59t$UM T$ $U؋Mȉrt[9]UԋM$ډ|$Fu9ދMЋE UCω$ML$؋M u15E9EhE[}]ԉUЉǍv]Ԑt&|U MƉL$@ى$EtJ9u܉u19}EBEЅt9}sD$E $M܋U؉yu븐E9E܉EE9E܉EU؋E [:0ML$$謬M M؉d$<[^_]Ë]U M܉$EU؉|$U M܉$EU؉|$0t&'UWVS$tEUEeU1҅ɉE[UP9 E U  EEEE UU UE}IMt$ʵt $^ËM9MEvEċut U:(M?*vUO;]ME;MuE9E8E t|U1:/t&~=&~ ]M ^$t $蚳;]ĉ] ^N"}[\ Me3  $[^_]Í&[\U9UtE M9ʉMr}t3$^t $ËEĉ$EtUĉ$ֲE9]]t&Uĉ$Mĉ $袲EfMą%}/ }.sE iM9MEREx/EM9M}.u E M˃1?*„N M }/M" M{ts;( Eą^EM9MEv Ečtt ;(;]3[?*}/u?uf덍E9EfE Uz/}ąE9E}.uE tU9Uu]tEĉ$<$M^ƒ! ЃEU[vU\Ut<$t <$zDžEt$迱t $SÃ/-N9}EĉUM=D$$ UMS]2΃[G= :+.*U Ƌ}ċE؃E\}>$vt&V]8\N[ut%$UM蠰UMt $.‹M9׍IUM=D$$UM]t%U$2MEM@9UĐt&unIu ,t&]\>t&[IuЋ:t=t .uэ&RōvEĉMD$$ M]vM9MuU fv9uU MT$L$*$fu1Hv~EN$F8@ :Xu8]uډM)U$NjUMRL$MUD$<$U}$MUԉ$D$UM胫UMEt E$MEEEaE$"EEԉ$E<EU܃T$ D$EԉD$E$踩MFEM$KUE$]EMUMĉD$ $59}_/1EYt&Cփv?t!t @E M9MDE UD$ED$$MUO7EsK <$M貥}؋MN҉]u_$M覬MI$3MÉ7&uBEĉ$j/t&EuX4&My/f}gN Lt&Uĉ$襪Et&.8U؉U؉UċR}1ɍCU}9t&IMUUD$$U蔨UMMĉ $[=\u E u}tU$tM $EE9E{M]ɋM Eă[]EUM U^vUt)E8(t!$D$u }u6t&UMT$ $>[9}}tEt($U+Ut $輨9Uu룍vE}-+v]t&D$EĉM$虨E؋MEU9U߉֋] v9M EL$D$ى?<$u1U$(M뙋^SMMUh&SvҍNfvUd$ȉ]] ۉu}u}u]u}]Ðt$ğ4$E蹟U} }E؋u]]5t&Ud$]u}]u }žE\$D$$vmEt$D$$vCE|$D$E$UEԉ$ǠU$輠Eԋ]u}]Ít&E$蝠|$t$$]u}]UWV1Sd$ċ]UM؋U };(1ɍEpF߃vd$<[^_]f$?[]UЋu|U EE̋E9E ;u؉ŨUf[9]9ދEЋUԋMClj$Eډ|$uϋEU D$$M܋U؉mu1&d$<[^_]Ã*C[EUЉ]ȋu|U E;u؉EG@E59t$UE T$$MȋU؉t[9]EԋM$ډ|$u9ދUЋE MC׉$UT$؋Uu15E9EiE[}]ԉUЉǍv]Ԑt&|U ƋED$ىF$E>tJ9u܉u19}EBEЅt9}sU D$$M܋U؉u븐E9E܉EU9U܉U]E U؍[0:E$D$耛U 2U؉:^U M܉$EU؉|$a E M܉$U؋E|$<4UWVSd$]E ueU1҅ۉEu*tUe3td$\[^_]ÅtEE$2Et}Ѕ$E1ۉu1E ]̉GfE]̃9]MȋE؉9EԅtEԉ48M؍14]̍E܉$tt<\E\뛍t&U؍E܉$D$ D$t$rBpMȋu $Mԅt Eԉ$ԛt&E MEȉML$U$aUEЅEUD$EԉM$1EȋUME؉9EȉEԉMt&U܍M؉T$ D$t$ $蚚#vuEЋUȅ]̉MЋEԉt&M{E;MȻ $ԚUȋu$軚UԅMԉ $襚u $蕚Uԉ$芚o0UWVSd$ċME ]eU1҅ɉEЉMEЋ04$膜ۉljE E1u?s<\uy\UЋ 2ɉ2t9}v<)Eԍ[Ẻ$趛uŰMԉT$ L$t$$8PwMe3 d$<[^_]ËM̋EԉL$ D$t$$뼍t&뽋EUq$}UЋM̉ËQE؋E܉|$E܉UD$ $E؉D$kۉ&$٘t&{USd$];t(D$=$u$Md$1[]Ívd$[]ÐUSd$]t;tD$=$lt裔d$[]ÐEtAE D$D$$_tύ&Q1Qd$[]Ív$@;u믐&UVSd$];toD$$O<=uW$ߙ$o$\$舚0TD$T$$L_tPPd$1[^]f諓d$[^]Ð&Ud$ȉ]]u};u1]u}]Ð$P9tR t$^1t$$-o$\$]u} ]Í&t#$9v@l@e$賘=‹7It!:u T$\$4$UUu<=twuD'Ud$Ud$$~Í$$Ðt&Ud$(~Í$̒((@@ÐUd$D$ D$D$E$覙ÐUd$D$D$ EU D$ED$ E$T$iFÍ&Ud$D$D$ EU D$ED$ E$T$)FÍ&USd$eE1U E߉D$ ET$D$D$D$ $E$Җ$l$\${Ue3ud$D[]vUSd$eE1U EމD$ ET$D$D$D$ $\E$R$gl$\$Ue3ud$D[]蓘U]Í&U1҉эd$+ t&D$ D$E$ډT$dxÍv'Ud$ӒvUSd$9] t0t,۸t@d$[]ÐED$D$@$~d$[]Í&UWV1Sd$} E|$D$E$yu8uvu͍d$[^_]ÍvUWVSd$} uEt$|$$͑y 袎8tݍd$[^_]fUSd$9] t0t,۸t@d$[]ÐED$D$@$]~d$[]ÐUUtҸ t @ u]Ít&1]Ít&UEP @@P ⿉PljP1]É'UE` 1]fUUB"߃0B1]Í&UE` 1]fUSd$]$m¸xc 1d$[]Ðt&Ud$D$E D$E$Í'Ud$]] u$ux] u]u]t&]u]É'Ud$eE1Ҹ $E E E Eġ Eȡ E̡ EС Eԡ Eء$ Eܡ( E, E0 E4 E8 EED$Ue3uf+t&'Ud$E ` Ud$ eE1ɸ $E E E Eġ Eȡ E̡ EС Eԡ Eء$ Eܡ( E, E0 E4 E8 EED$0Ue3uf;t&'Ud$E P ߃0PUd$eE1Ҹ $E E E Eġ Eȡ E̡ EС Eԡ Eء$ Eܡ( E, E0 E4 E8 EED$0Ue3ufKt&'Ud$E ` Ud$ eE1ɸ $E E E Eġ Eȡ E̡ EС Eԡ Eء$ Eܡ( E, E0 E4 E8 EED$0Ue3uf[t&'Ud$]] u$ux] u]u]t&]u]É'Ud$eE1Ҹ $E E E Eġ Eȡ E̡ EС Eԡ Eء$ Eܡ( E, E0 E4 E8 EED$Ue3uf;t&'Ud$ uÐt&D$ $D$@ $Ít&Ud$cvUd$tÍD$ $4D$@ $ ÐUWVSd$uL u=1}ȹE T$D$Eȉ$KEtEd$l[^_]Ít&뼐E$趎EĉD$ EUT$D$D$Eȉ$U$EUP U$d$<6?$<JDE@EEuoEtite11t&UD$T$$葈Uč@)UT$D$$U|$\$ D$$L9}sEH$\Uĉ$QEȉ$6Ed$l[^_]ÐUd$eU1ҋE]u}] /t.\$D$$ʆUe3u{]u}]Ðxdu̿uuE/devE/fd/ED$ @4$D$\$t$$Zӄy&'U卤$xE]u}] 8/t\$$6]u}]ÐxdIuPioeu:RHuQ:SuQ:TuQ:Uut&U$T$q¸l(uEI;E]較 ]u}]Ít&:gHQ:hQ:iat&?&:HQ:Q:Q:rt&]u}1]ÐE$bE Ud$eE1ED$EUET$$¸xUe3u'Ðt&{ku1݃Xt諊UWVSd$}<$$0^É|$$ˆD$/s 4$σ@EUGE11}tT$4$E̍ED$ ED$u1tV&F D$FD$F$OxIVFD$T$<$賁yWFt]<$vu$d$\[^_]Ívu${訄E$vE$ƋU$s<$vE$軁Uxt1$D$t$$N0諀B$迆D$ED$$ND$D$X$:$|$΄USU] E R+S+ ҉Px[]Ðt&I@BɉPy@[]ÍUSU] E RS ?BP~IP[]Ít&'UWVSd$U ]E [Z ?B~ I8pI= < )E츃C JmE)ËEi@B)؉ø )E츃C/uMbv>EUOU߈ 5}tVEpELjvSEU2UtȈEMD$E$~&E$|{EUWVS$]$eE1}$Slj$c}$xS$\$ ~EtKfE &uƉ$h$>$\$4iMU7ۍFuɋE0d$,[^_]Í&'U11ɉd$U:tt&@<uD$ r D$L$$b Ud$E E EEbvUWVSd$ԋ}E 1&vtf:uE \$$U0mUu؍ t(D]䍶\Rۉ֍@u]$dd$,[^_]Ðd$,1[^_]Ðt&Ud$e t4$^$ 5$@'DŽҍXEމJf]DQ@u[0\F00^Fvt:t&Cl(;  $ о̾DžDž1DžDžDžDžQܾܾT$ $D$D$ UD$ D$[\$D$ [D$ D$$Z[!%tDSD$+̾T*ډ $Ux.tx<$U =v̋|$ $V$D$T$$IQuċPTld9t9M9s>t&cO$ $VCtDž%sWD俉̀̿DžĿ Ծ󥋕 4; ; \ |;X d;@ ; H  UWVSd$ԋu M]}F>E\;ECfkt&ȃ0[uE|{0t 0[&Et-[d$,C[^_]Í&E e]ٍ\;E-C[&ȃ0[ubD$D$_$PD$W$T$N;Ld$,[^_]Í& 7E-gfff#))ȃ0 C[R0[t& tc@vR01ҍ[1҉ v݃#w@RW֍vEC0 X[ wkI0 [?=wCR둍Uȃl[uȃ}t&>_DCx4gfff&))0҈ [uȺ)A0ш[뭐UWVSd$ԋMɋ]u }UE>E|EG}}t&0 uE}}0t 0t&E܅t-d$,G[^_]Í&EE YQۍ|E-Gރ}J&0 ڈuRUD$D$_$MU؉<$D$JL$KUId$,[^_]Í} E#gfffEME))ȃ0G} R0} }DE‰EU?t&> Ѓ_EU$t$D$T$ É >UMT$L$ $t$w #f=w@f떍EG0 X w vfω$|$D$ D$ 0$|$D$ D$ vpÉ ؉up&[0\v@0@WU"؃l uډ؃}؍t&$t$D$ D$ \0$t$D$ D$ ÉUWVSd$TueE1} t&D$\$4$Dt|D$\$<$yѸUe3u $[^_]'OUWVS@$DE L$@eU1"PDžT+vPTd|$T$$<UdD$D$$st;T9f9}P\$$|!PyTT9}>TPLtzLUe3uw$[^_]f9}P\$$!P랋P$ILpL_P$H{MUd$ء]u]u x3UD$TT$$IuEftUfu]u]ÍT$$ED$E$bYtEtE봍t&$[DgUd$E$^P1ÐUWVSd$ċ}M E 01ۉ}ԍEtyMUD$T$ $7~qMԍS9w.ufU |$$MM Eԉ8E} [ud$av?}Dx=tC fE&1҅Et&EEUE܉U[ETt&Ect&<$xCvKBU卤$U]҉u}xw 1`󫍝Љ`ERD$E`E\$ D$D$$@]u}]ÐUE]Ð&UE]ÐUd$eE1uu ]/}]w0$t$:ËUe3u~]u}]Í&9vƉ$EE>u;E܉|$D$ \$$;Pwu 9t)u1t@UWVSd$ԋE}u EE\$t$<$ :~ )Å~4uE}~ԋE)؉EEd$,[^_]78tEᐐ P&UX&T& ]U  ]ÐUUT&X&BP&B B BB| Bh B%B @B$l B(HB,DB0 B4p B8t B< B@BDTBHXBL1]Ív'UUT&BX&BP&B  B BB| Bh B %B$@B(l B,HB0DB4 B8p Bt&UWVSd$}~g 1ۅu&[9~I5 t5T&t- 95T&uыE [D$$99& u  u d$1[^_]Ð 1d$[^_]Ð(빐USd$ ҋ]t#~E $D$XT d$1[]Ð ̍&USÍd$tt& ${Eud$[]t&'Ud$]áT&;X&u| ]u]ft t]uT&]Ív5T&\$$9;5T&uX&T&뢍USd$] nPhp l@1d$[]Ít&'Ud$T&t;X&t1Ít&v t -T&1fT&D$D$ $"T&볍t&'Ud$v t -T&Ít&T&D$D$ $ʜT&ÍvUWVSd$ԋ5T& } 0$E@E؉Ev9EDžt>t t;^;X&}` $';Euu‰T&1d$,[^_]f D$ D$t$$藝;X&|t&%d$,[^_]Ðt&E؉E9EDžt:t t#^x $s;EuĐ D$t$$_19)fu}T&] ]ࡨ $Euo|$$-6T&;]uʉ5T&$&X&9}ډ|$$5T& $EtƋ}~USd$E ],uE ډ      L$ D$ T$$11d$[]f;tCTHFt&u  f tF   뇋 pt&ft{tu΋   uj th$ DP@ 1d$[]Í  _&  ?D$$    vUd$D$$ E£ Ҹ~6 T$ D$ED$ @($/Í'USd$E $D$-T& X&9}. @T&9} t t捶d$1[] Ud$E|USd$] $\$-Php l@1d$[]fUVSd$]ۋu X&'v t@ T& X& $9NЉT$xT&~;X&t?1d$[^]Ðt&T&D$ D$ \$$Ƙ T&럍t$$x1d$1[^]Íۉ]d$[^]& |Ud$؉]]ۉ}u} 5T&~*v t{v t?T&)أT&xt$$k1]u}]Ít&T&1fT&D$D$ $T&먍v|$$t0T&뒐t&ۋu]}]]"fxUWVSÍd$ԃud$,[^_]Ðt&t t&t$$XE[tYT&;X&}KUt$$T&U9~@T&vu<$A<맍&t$$/ d$,1[^_]Ð&UWVSd$E=X&T&WU9@5 E䐍t&< t< uT&t& u/[T&9|U[҉T&ti9]~dm뷍& ẗUUAuT_tO[T&9~Qu<_t< t< uڋU[҉T&ud$1[^_]<_t[T&9]QuUWVSd$}5 t~T&~s< Et< uDEMHu 1Ҁ}_M Hu;}_t5t}_t  ug[T&ud$1[^_]Åt݅uD< Et< u[T&DEEX& tHuJ_tE[T&x Hu_t t u׍t&[T&X_uf[T&xHuݍt&UWVSd$5X&= FEEEMt&T&9]~mQuz<_u*t< t39~/[T&Qu<_t< u9~[T&< uO9mMud$1[^_]Ðt&[T&Qu<_u9< t&t< tm믍&'Ud$]]ۉuu xADput$$O1]u]Ívt$$]u1]#ύUd$]]ۉuu xiX&;T&~A$Dput$$O]u1]Ívt$$]u1]]u1]Í&ۋu]]] 'Ud$]]ۉuu xaT&t@Dput$$V]u1]ft$$]u1] ]u1]Í&ۋu]]]t&U1d$UtT$$ÍUWVSd$ԡT& h @u P&-%h D$$CЃ =Ld L h NukOx@:u zpQЃ Vd 8LDAУLd @Nth &=L%@=Lh 1%h  5X&  0 FX& D0@D$$ 5X&05T&X&9~T&֋=P&9UIUX%Et~U˃1ۍt&d[T$$:`u `&d$[]1t&UW1VSd$\&1ta11E't& 2[ 0 D4t-K;M~ՃEU$T$\&뷍&|$$ED$ D$Ed$,[^_]ÐUVSd$utN1t&<u D$h[t+<u݋D$D[$:uՍd$[^]Ív'USd$]$}]d$[] Ud$$=t&BR9uÍ'Ud$ &D@ Ru@L@ ǀ @D D@ RuÍvUSd$]P1ҍ ӈ ЋLLRud$[]ÐUd$< T&  tD 9}B ^T&T$ T$@$T& D1t&@ D$ $O 룐&Ud$؅҉]uy؋u]]Ít&MU;UƉ$<Mt́ h ;^t.$L$uÁ%h t;É4$;딍[L$$t͉'Ud$X&D$T$$#$Q Dt |t$G0|ÍvsِUWVSÍd$21[ ts  tZ :¡ U$:;UƉ$: tS: uT$$UUuut3 T&X&P&d$,1[^_]ÍId0t& T&X&P&d$,[^_]É'Ud$$t$]u tHl = t =@ t  t61҅‰t$1؋$T])1$t$]Ívu ]t$$];2t&'Ud$$t$]u tHl = t =@ t t61҅‰t$1؋$T])1$t$]Ívu ]t$$]2t&'UVSd$8 эtW 8ơ $88áDuVX&T&P&d$[^]Ð{.T&t&d$1[^]Ð4$P8렍&'Ud$ tF Ud$ t USÍd$-<C$T&C(P&W%h d$[]ÍUSÍd$܃ ~Cfu3T&T$$Et&tkt҃taUUv T$$"vDd$$[]Í uvd$$1[]Í&d$$[]D$$,fD$$f[H$xUVSÍd$ T&@(ɣP&u# tcS@ d$[^]C,  t$75 4$i$~$t$ 苇%h d$[^]Ít&Ud$]]u$}‰t]u]Ít&x$D$[|%h 1]u ]Ðt&UWVSd$D$$~C,s@C<, :DT&X&<$D$D$$44$h 1 h u[t&$|t‰|FuƐx6D$$>{1%h  d$[^_]Ðd$[^_]fH U1Ҹ/d$} /DиU1Ҹ?d$} ?DаUj Ett tҍЀ:uB@  tҍЀ:uB@  tҍЀ:uB@  tҍЀ8u@@ ]Ít&'UVSÍd$8u.t$D$$lx؍d$1[^]Íd$[^]Ít&'U1d$ uÍvp $` qu ÐUVSÍd$t$$y8td$[^]Ít&1F t$Pf 1Չ'Ud$ t1Ívp $[` q¸xً p d   t   x   |         `   h    l     p   $ x 1p $Uɺ` v'Ud$D$T$]u}É׍ut$t)<]u}]Ðt&t$D$T$fUWVS$d]eE1p $U`E}̉lEp}E}Љt}E}ԉx}E}؋Muĉ|}}܋UMuMȉ}}UM}tÀ8u@ tҍӀ8u@ tɍˀ8u@ t8u@ Ee3u $[^_]/ Ud$vUd$p $|$D$1Ð&Ud$t $L$D$1Ð&USd$ ud$[]Í&Kp $á&u;t $V Zx %h d$[]Jf$뷍v'UWVS$D eE1tMe3 $[^_]fp u$KE ` E$ E( E, E0 E4 E8 Eģ< Eȣ@ ẸD EУH EԣL EأP EܣT 1ҋEɣX t D8$`        5  <  A  3  ?  4  =  1  2  ;  9  :   h @ Ң >  D'}MDŽHUMt'dd<<uG tɀ<<uG tҀ< uA Ht%H<u B  8  M < M @ M D M H M L lM$  P 0 pM(  T t|, 4 M X UMfxe%҉ x t ҉T}E00tvE%EEEEEtEEZx4 &t $t $#  h -Etux эv_uꐋE}ȉl}E}̉p}E}ЋMt}E}ԉxMEM}}؉|M}Mċ}M}}}H@M}t€8u@ t8u@ tɍʀ8u@ HH€8@ f@$S`UE9l t" !u= Ƀ@]f ?u] Ul&x&]Í&Ud$؉uu4$]}}$á$ Ct$$lt $ ؋u]}] UVSd$ut0t$ C[uud$[^]&d$[^]Ð&USÍd$E\$D$$tPU/@t< %t2`#t(@t=t|t t 1d$t[]ÐD$$¸*t1ِUSÍd$0 tMD$/$]t78t2y@u+Q9sy/u *f:/t#R9r:/t&؍d$[]Í&Bt&'UVS,&tWt tz tuQtPqtKv h @/%h Yt9yt4 t/Ntnttyt&랐1[^]vÍ&[^]Í&[^] Ud$؉]1ۉu}։t$ t 0 u؋]u}]f,ttt҉$T$tǡ( tD$$tt0t|$t$$Ћ]u}]Ð&UWVSӉʍd$ċuEEtEE$$rbE߅}8Utt5 M:L5T&u}uEԉE5 X&9}&t [v9} t:t9]}>tM\$L$4$U 4$ÉT&9}t}d$<[^_]Pd$<[^_]Í&( :T:['u\$t$<$ 랍v:)5 M::TT&E&U卤$h]ue]1ۅɉ}tT&1u@ ub4tXT5YD 0 uUT&;X&t%Ue3]u}]ÍE$΍vˉD 0 t$mdUƅt h&}t$|$$uE%=@=t~T&;X&tE4$K5D 5 \9Mt&E$U뮍v}t$|$$9d|$t$$fE%=@S[=MT&t* u$|/+$ /uH&UWVSd$M ɋ} t$G  t$L t$; t$*<$b$w$|$ ?=<$5$J$|$$D$/ ENjU@D$ $G= <$$$|$|  8~ t $ С t$ Ѕpl&t38 t*x&T$ $Љǡ $=  $=  tl T P  : =` = 33 ` %5d d bYth $L T  1d$,[^_]Ð0 h \ h t$l h t$l  %h d$,1[^_]Ít&X h ED$H $L P T&{h t$jh  1d$,[^_]Ív\   DvT $L d h l \$$$H  L  uvh t$貽h d  1d$,[^_]ÐA;` ch t$Rh X j\ H $ L lX >t&d p|$$Ud$E؉Et&'UVSd$=l  u t$蓼 t$BE  t& h @    0 , %D @ 4 h& T&11ɉ x p Et T&T$| $'t  x T$UT$|  $ 0 t Cu_j t$Y  t$>  %h 1d$ [^]Í %h  t-vÅҍ@u ~ to te5  |  $t  1d$ [^]Ít&K t$:  1d$ [^]Ít&ED$p $Ut x T&"  0f| $t >   \$$$p  t  v  D]t&'UWVSd$ċE  h @ ۡ 0 ,D @ 4 h&Et"$$4$\$ȻEԋ  ҋ=T&EED1ۅEK=T&|$UЉ$ƋUE$D$E؉D$ډ1Et4$D$54$5uE0 |}*} }!E$D$}ؾ}ԅt Eԉ$Ʒ%h l&x&d$<[^_]f蓾]ԅt Eԉ$職 %h l&x&1d$<[^_]ÍE܉UЉD$E؉$ET&Uf}?N}@E0>txɍE$zEHY}! }@(D*f$puԅt,EԉD$ $腾 Eԉ$}%h l&x&1d$<[^_]Ít&}HEtT&$D$wGT&_Mlj$ $8;>t<$ޅ[u葧EEE :D)iэ苼E<$UMEM;É$a$8U;g$5ZUd$E E*t&t&Ud$E E?t&t&Ud$E t&d&u@=l # tL u2 uE \t&E@KvbfE!3v uE?USEM xQPw2\t(@u*$CH1@H&1[]Í&'USd$@E@E D$E$h@d$[]Ít&'Ud$D$E$6Ít&Ud$D$E D$E$Í'U11҉SM ] Rt$<u9\uDRu[]Í&'UWVSd$M ]D @=\11}.t&ҍ uR|3@JƄt_yӋ}t̍}udOҍ tv|3u!]tEɉBd$[^_]Í1d$[^_]Ðt&ut׋}B̋}tEɉUBƍUMt(1ҁut&9 ՄtRՀu]Í&UEt@] U@]ÍUDtu @]Ív@]Ít&UD=itҸD]ÍUSd$]tI;tDD&t$ $C$X$\$D&d$1[]Íd$[]ÍUd$Et8u$1Ít&D$ D$$@¸yÍvUd$Et8ud1Í&D$ D$$H£1Í'Ud$Et8u 1 1fD$ D$$蘯xף 1Ít&'USd$]D$D$$-tAD$D$=i$¸u@D0d$[]Ð@Dd$[]Í'USd$];D$$贲D$>$蜲tpD$$舲tDD$$tt0D$$`¸u!X0&X1d$[]Ðt&X1d$[]Ðt&UVSd$ut;1&[݀t"D$4$ֱu݄d$[^]Ívd$1[^]ÍUd$E$¸t@0É'UWVSd$$)ƒ$E҉tUt&FwU\CMC-["\ Єt\[[uEd$L[^_]Ãx\CCC-UM@Eč[UpMt جU؉у@ɋM܋MAUlU0U薬U؃@4&\e[\CCC-?[&\fe[EUU؃@ҋ4@ofUd$$uƉ]}B&~i1rw$;\20yD 0Iȃ"\ ؋u]}]Ívx\CCC-芬8@WMtU@UɋG踰8E@;\ISt&\@e@؋u]}]Í\@C@-@?@؋u]}]ÍMtd@f;@Dt&UWVS1ۍd$ĉE܉Mf<[<u}EtU$ ELUDžtI$UD$ E؋EU؉D$$蘬EE|$$膬<$螀}؋TE܍[:<$肀Ud$<[^_]Ðt&AEDeNjE܅t\mMmEׅEET$D$ Ut T$D$D$$舦E$<$EmD$ EׅmEET$D$ Ut T$D$$,fE$ڀMDžtE<$D$bU\DeDU1ɉd$@E&Ud$%tt D$D$$蒥d $41ÍUd$؉]]u}Cwu \ M -"ƒ\ ¸tcƀ \S؈ ]u}Ƃ  ]Í~B"ƒ\ 1ҍXuP뤐 \e닄 \ C - @8wUt衦ڃ@ҋGB}0p@4 \1Ҿe911.t& \ C -1Ҿ?fMu@ۋ4`@yv'UVSd$蒧t?t1t&D$ t D$D$$?C[uՉ4$|d$[^]Ðt&UWV1S1ۍd$EE)f<tuM E9D[6U <u΋U DtۋMD$ $Etŋىڃ@@M҉MىUċ}ЋUЃဈ]׃UMω]}M MtU苤MċUB.MȋɋEtUZMċUD$D$ D$D$$t&U$D$ߩM$2{F9E|rU܉}v$"$7|}t_}}}"t}\u\MCKlt&E ED$E܉$O{Em&\tE D$ D$D$$fEC]MЍ[ $/zE܍d$\[^_]Í&UȋE͢UxvD$ $D$D$$`{vD$ D$D$$8SvyǍF;EM܉$u=@Xd$,1[^_]Ð1 u⍶v[ tЉD$<$訤uxvtUUd$,[^_]f11=Ex+$(mUWVSd$ }J9 5 =  t8< < Gt& @ u5 t D$D$R<$舥D$D$X<$h_D$=i$mtD$$T;D d$1[^_]Ðt& @$ D$.w J&<<$D$ߢ d$1[^_]Ív4$P$ew$t$$D$-t_t$$聢1҅t $D$j‰4$ ud$1[^_]Ít& $v J Ud$ uD$$zÐt&D$ D$ D$$^vzÍt&Ud$t6~! 19u t&<t@9=  1Ð^1Ív'Ud$t P D 1Ívo1fUWVSd$}辞5\&u (^vt|$$uCd$[^_]Íd$1[^_]Í'UWVSd$át D$D$$肚 ]䐍t& $MU@$T$3MƅɋMytJ^u΍vD$ t t$D$D$$߉$ws[uƋu4$csEHɉE_d$<[^_]Ít L$ D$D$$藙t\11ۿ} t@T[ҺqD$ t DD$tT$D$$Fڋ~t'Bv$rC[u&tաt D${D$$붐t&t L$ D$D$$ǘt L$ D$D$$衘Ud$血%tt D$D$$cd $q'1Í'USd$E] $11҅u 0Rt%<u;DuDRuܐd$[]Í&U1҉WV1S1ۍd$ԋEu%} RE[ tn\uu[4MׅtSCEMEt}t }|-tSM׍qЉHvM E׈R뗍$`v֋EU 12d$,[^_]Í&tj}M}?E[4?UlUDxnU܋t&E z[&u4DPU :>WU܍[U܉E1UЋU UDr1q ɃW@ύ[뿋M  R:E  R+}  RM  R E  R} RM RE R} R} \R}KM@t~Љw0{M}Dt~Љw[]DЋ]} RTvqw@Ƀ7vUЉ} [ R#MMɋ LɃ0 \[t@uM R}|\t8M} [ȀRxUEf.|Cu|-u[4? U貗UDxtLU܋ȀȀUWVSd$ċ]$N$cn$\$át$<'EuJEKC8E t&8U׍@tE<uΉ=t&<"tE tu ui tE @ u$茗D$mUD$T$4$E$3l1d$<[^_]Éމ뫉맍&'UWVSd$ċ] ۋu;$D$mEЋUЍET$D$$bfM11ۅOf4Uׅvt t1M5&9~kU׋UPw!\t$f[9|teUPUM9ى5&UEЉ$j1d$<[^_]f~U–FU1G4fUpuEuE xt&rPPẺ$rjEUf}t#d$<[^_]ËEЉ$IjTE$4jfUVSd$u 4$ l cTt& RL C @ɉuߡ1[D$4$ uމ<$17;t< twf< [uf< vu|1҉uԿމ[ hD$4$|uډҋux@4$D9r  t h@9sxPt9rt$$a1\1K}ԍ@< nD f @uDŽu t퐍t&|vSf…u%&1ɍ;…tu\t'"u҉7^t&뻀| =QN#< jot&u< t&2< tv8< uv" uЋUUD$#4$襎t;4$yUԉD$$z1e4 lj1EEE@D$ D$E$D$1r1щ $bE1St?1ɰ}ԉu \t""TTptɍptوTuЋU"uw1уt D:u@}ԍvD$t$<$Uԉ$`1 ,< vQ f't4$vD$Eԉ$\랉uЉM<'UWVSÍ$d $ $Et$D$^E4$`M$}u} 9vxv9> F1 @ t 9Ǎ[uu,v[t< t< t<#t t4$bt9wU$X_ 1$[^_]É1됡 91t$$9$N`$\$ $bM$[^_]D$D$4$}Mt$jՃE_ȃrډxt$_txL$$ED$詆x|$|x-u|EU$a܋E$]E&U1d$؀= ]u}uIED$ $5 謄=tSE5 =]u}] Ud$Et28u1Ҹ7¸Bt11Ít& u$/Vt볐t&Ud$$Dtu @f@Ít&USd$E] t \$$!E\$$Bd$1[]É'UVSÍd$D$O$u!Xwd$ [^]fD$$uD&Dd$ [^]Ðt&D$$萈D$Z$xPD$G$`D$q$H.D$~$.D$$ @t/1ҁu; Մ RՀu名t&D=iҸD D$D$ D$ D$$ {d$ [^]ÍtgtcD$D$$ 輁$Z  IvD$sfE5&t$Z1  UWVSd$ԡu>@fS ɉD$ t D$DD$T$$tC [ tBuSD$ Һt D$DD$T$$2C [ uty 5&D$t \$ D$D$$ t=tuÉD$t \$ D$D$$ uÍd$,[^_]ÍUd$血%tt D$D$$cd $q1Í'UWVSd$䡠}tJ1 v[ t4D$<$uv>ҺEd$[^_]á1 u>v[ t,D$<$uxvd$[^_]d$1[^_]ÐUd$ȅ]u}ÉUt 8!1$Y(E i-se@archf@)`@ t U $\$`U :': t$$4$[W]u}D]$`Ǎ@!_FFreve@rse-@ W&UWVSd$ċu ]@8uF@=@e = e %= 0N&CDD$Cd$~}t{D1d$<[^_]|v=CDx"P@S C95r|={{H1эypK 1MʋsLH@9Lj RS u}C8{x$$w1CDR{HH{I>fCD)$Iw1f$CCDCDuC@؅C@{{s`{C\t&K @)ȉ}ԉE9t>C {XS<7} :s@{s`}Eu9uu‹}SD$ 4$`@D$$O1{CD$$%C1t$Wcd$[^_]Ít&d$1[^_]Ðt&D$$1҅t $b‰뗍t&Ud$D$ D$D$$`E D$ED$_ t]`,`D$$ 1҅t $Sb‰D1Ð< Ud$ȡ4]u}u/0U9ЉEu:u6]u}]Ð1; uա0U+9ЉEtɍv\ 9U~=t9ҋu  1ҋME $9U9&9|W 4; uI9=?9;))9U~/t&)Df;&Ou9u'\vJu@0ÅtMV)9|Dlu3v9u|c50]u}]f0)ډ뺍v;&uȡ&D$ D$$a0E[vN=uD&]f&[D$ D$$(a9R&];]f=u}u t D$[$hd9ut&E)$ eE=9u 5D~vME $5DR&D$ D$$J`]ru1ۋ}u t&t D$[$c9+ USd$8t 0t5$=8ct $\ d$[]ÍvHZ <u@8$lt H8AD);&u@\$$H$t D$&D$b>t&'UVSd$| $]HD| \$$`^L\$$M^5| D$ 4$gZE4$j]Xv 0 lڅ5&4~\PH1J1Ґt&82@9~| ,1d$[^]fPtH1Jč&1҉$60At&D$$bS UWVS$TEUMeE1W!= 0&90[WR=DM 9MN]9ۋu} U]+}9}U} ɋEMt&>g@v9+}9։]}}9} T ;K ]ĉߋ] t&?t @9]9!Me3 p$[^_]Ðt&4 0;  1ҡ&)9l E;4U=HU;P}@ ~$1M̉ttUMỦD$T$ L$}ȉ<$nWƍ@G;t $ D$^M049}5&9N)vUE  U:  ]U}t& ]: @R9ǍR[މ+ME]MЉEֹ&+E9։]EvU`TUv = NMčO9{ ;Ur EEEu:Z }uut&9s:u< IvE9r}uċ}uEu}uċUMҺD9 4UtR $St t7MuA 0 uЉELvU EUD$$M+M+EEMESv EEMuE u;U;t0Ri \ +EEE&+MMRv eMU 819E|19E‹E) =t( 9E~ 5&tl}M|$$\M 0RyE; j]9O] &);M40D)‰00 &; 9MMSQM* = 09&MD$ D$$V=MtD$$[ML$M$[PMv = ʉ0 0EMUD$ $PUG 9ҡ0(;D f}Ā?t4 =0E;}MOM}M|$$ZM 0O0}%5 U9SMoOMv3uu,=u#=tU9|};=8};=) Ot =tE9EtUD$T$$0& MD$L$$OV$D$ D$T}$|$hYu+uU0]t$$BY}Nv =50`N}=M9 )0D&UĉL$ $MD$D$D$D$MUĉMU:,EĉME9MMMv EčIEM&UډUč ;U t0u M tW}tP};=&E&t :8t-}t'u&D$ D$$RuދuUE$D$WLv }=0 E~ZEMD$$HWM 0zLv5 u+Uu$tU9|)0D+u]3L)v6u-1ҋE$`É1+ME$H)ÅmKt u0;&HM9Ml~1t vD$$ T90} 9}EEEE]E,U:]UM܍Eԉ]11MEat$D$ D$$ƋU|$$D$ D$M3ЉM)9EY:gEMD$EU|$L$ D$t$$XUm]g+&)5MU+ME$EMU+ME$)E/U+ME$d+ED$EuD$$^EMEĉ+E $D$D$<MU9;UE܉}E]EԉuEU]uWt&Mĸ9 EET$ED$$D$EċED$4$ 9MsgU9Us_U)EEGBUĉD$)ڋET$UMD$t$ |$$UMO}]uE}Ā?E$D$cS00!HMvE EM)EUU+MM]m}$|$R$1҉iU0ң0tM9 e)D0O]UEcu}uu1ۅ}UM::]L$\$$PQf+}EˉM}E]1UEUEU$M$HU}t T$$@Px+MUL$D$ D$$MEEMEċU+ED$ D$D$$EME|$|$$M$D$ |$1LkM1+M$]1E}‰}EEkM1ҡ$9D+0,&t 8&t8uuGE$D$TP&8D$ D$$FK&D$ D$$$Ku뚋Eȉ$Ou~"1ۋUt D$[$dN;]|1=0t4}DMỦD$T$ L$<$FW@UF1ڃEуL$T$$LUEt$$D$)HUMu9ʉH@R9|E+E]Eֹ?D$ D$$I; UWVSd$eE1x u}e3=td$|[^_]Ð=, h J5@cL +HL M11H=,1: D ;=|  t=t M~0T0;P]ȉD$$D$\C5E+L1P ʉUЋP@ $T$D$CUЋ &ЉuEE19MЉv+BREL79ủR[9Gى$;&~ҡ\$uD$$É}̉‹ 1D LUԋIoAxLkًU̡$)Ef &E9MЍv߉u Av=nEE};=X&EE/f }8E@v? u5E UE؉$`JEHEĉEčNP9E;T&U̍B EȉT$D$ D$D$$+I}С&9|,=L+MЋGP9 W[1)ωvt&?v E}Ћ};=X&E0 H}=LGP9Gt -& 8 95&1۸]ԉuÐt&L 0DM;=8P 4M HEȋQ M̋ HE+MUԉ $T$U)T$U ;= 8 uUԅI L@@;}ԍ[J]ԡ89 9}" &$h9=8y HP04<$Gt$$;=8u4$B벐t& &)Mf U&ɉ%9uEfủډ}v  .M1^EЃ;&v}ЃU@Uу@DHDo?U@EȈ0;=&v#=LGP9G[UЉ4GH94B MЋ}<1=HPD$M$=LPD$$LMEȋE;T&5H]v?.EEԡX&+EԉD$E U܍M؉T$ D$ $=EB&|U;U &UU99Eڋ}E1FfGR M̉}4GH9M}̋A 81&M9Eȍ[0 &9Ǎv|ڋ=LGH9| OUD$G$HGU=Lg&EЋU}ƒ)¡&)щ)9=9։M @9=LGH9d[}EЋG4GH9M}ЋA M 8 &= R&8U2=LvGP9=G[14.MȈ1}Ѓ;=&v =LGP9= [EЋG4GH9B UЋM1 v=L+EЉEЋGE9E[+}9EȐt&0 v9n=HP}Ћ=EЋ)E̋E)؅DE̋ &EĸVUUUU4)A;EĉUM9E| Eą  U1< &<;9}}D> tu;Pf0=&EԡL1ɅD =HDL$P1D$<$_ 8 = D0;Et#;~U;}+0t&1҅ۉu);~9 1D))ơ&9Ɖ5~L؉D$H)؉$Pt $V:LHH ңL P%h " +t& OUD$G $ G =L}UMEEEE'&WD$G $G Lf OUD$G $}G =L}U OUD$G$MGU=Lpt&WD$G$ G=Lf@E;T&}EEE9Es2Uԉ}Љ]̉ы]ȉǍt& I9ʈ3vw}Ћ]̋Uą1҉ủ߉:fFM̍U FP9}VA MU1[9]~h@;&|5LFP9|VD$F$-F5Lf ND$F $F L뇐t&ủt&E;T&]5H]ӋE)؃$D9EO]ы=Hʁ))УPD$$_=LPD$$DEȉ!WMD$G$GM=LWD$G$ G=LM; 48 $3t }t0Å0:33=;0~k=tb&tD$ D$$8=\$$=2v =0LH @0)t 09w2v t ;0 L0$t$t&1Eȸm|t&E90E+v06EUMGED$G$ GM=LUF1D0;E;M; +0;&215 D0;E +&)9c+0PWD$G$ G=L8WD$G $ G LWD$G$ G=Ls  }Ȼ*GL1>5H]u;U;/I=<&+0$<$H4D$<$L:E܉D$ X&ED$ D$EE؉$51E_t&1,mD$ <$0t P׉<$3Ɖ£F;P]ȉ|$T$$x/}7=Wku/:.v 5&=MЉU%)ȋ H)EЋEУPD$Mԋ$bMԉ LPMD$$AMEȋUЉU)<$D$E8EU~ z &UD$ D$$~3U0; &)ȉ$课}̉LMH@4)LUЋ]ԃ}؅1qQ;]L]MLHR2)b,v =t,߅M09@)$6=0+H1ҋ$+=볡&+0I&UD$D$$赫Y3D$$6G1ҡ$[+0PUSd$܋ ɋEtvdtltkuYcx/E^V/ڋ@DPtx-@Ct&]ED$E$%6d$$[]Í똃uE^?]Et&mt&@ٍt&'Ud$uÍD$D$@$1Ud$uÐt&D$D$@$1Ud$ tÐt&$\)$@P)D$$2D$@D$$01Ít&Ud$tÍ$($@(D$$1D$@D$$0Ít&Ud$mt@!Z`t&US$\ Tt =tjXt =t$1[]Ívlp$(\$D$ $,1$[]Ílp$'\$D$$+\$D$`$+\$D$$+\$D$$t+\$D$@$\+\$D$$D+\$D$$,+'Ud$$ t#ɍv{t&'U卤$]uˉ1}׺DT$&C$&\T$D$4$g*0 t#ߋu]}]Ð\0 ufU卤$H]u}։ljˍ`$ &ىt]u}]Ít&\\$<$D$)]u}]Ðt&U卤$X TtN tDXt t 1Ðt&  41Í$D%D$D$ $8-0 `0 0 0 jt 6@0 z0 f0 RD$D$$l,&$ D$D$$ -D$$ ,D$$ ,D$$ ,D$$ ,D$$ ,D$$ ,T >lD$D$$j'lD$D$$G'wfUd$t  $_ Ud$ h 7 vU$Ё%h ÍUVSÍ$ph ΀h ٸpx$s4${"t$D$$s*\$4$("$\$&-D$t$$>*h h $[^]Í&t=Z_t&Ud$ҋEuj u Ít&&Ud$EU1]É'UE0 ]ÍUE0]Ðt&Ud$$\&US$LeE1t$)&4!tD$D$ D$D$$ +$&D$$B#Ue3u $[](v'USd$] tLU\$ T$D$$$D$D$$d!$W$d$[]먍t&USd$D$D$$] !E\$ D$D$$$D$D$$ $#d$[]Í&USd$]$M%$b$\$%d$[] Ud$Et "t&ÍUd$#UDPÐt&Ud$#UP ÍvUd$#UP ÍvUSd$#]DZt 0"ۋd$[]ÐUSd$c#]DZt 'ۋd$[]ÐUd$E E EEvUWVSd$ԋE $ $NjE$#9ljE?1vE[)9,uE މ|$D$4$'u؍d$,[^_]Ðt&1d$,[^_]Ít&'USd$D$D$$] E\$ D$D$$!D$D$$$! d$[]fUWVSd$ԋ5T& X&9΍^ D2<~u< tfx [< u[t&D:w< t< t9< u<~td$,1[^_]Ív< t9~<~u)؍PUB$ǡ U؉T$<$D$IU<$芢E<$Et$\$$HE$d$,1[^_]Í <2~$4ljt$\$$H<$/t&Ud$؉]}]} 9u~؉)ߍG$ |$\$${>]u}]Ð&USd$ ]9|2 $ T$  9~ٍd$[]&'Ud$%1Ud$%S%h tul D$$%t&Ud$vUSd$]$"¸u 0ud$[]Í&$)\$%d$[]ÍUSd$#]Zu 0ud$[]É\$$)d$[]ÐU1]É'UWVSÍd$ԉU:^Et~1v^9^ƋE$^\$$D$j8tiT&$o/Dt&$A$1d$,[^_]ÍE$D$$8@빍&#$#멐&USd$=l  ]U t^d `\1Ʌu$$1҅‰d$[]Í`ڍt& u&~J \ ɉ x띐t&U U͍v1rf \ى \U1ɉd$U E t&'Ud$t'T&$-$m?1Í'Ud$ءl =` ]u}t = <<$;T&)xt$ 2 :ukD$|$$!uW\$4$+:5T&x$D$$]u}1]Ð͐]u}]É'Ud$ȉu5` ]}uto5 N U܉$<L$U܍8 ` u25]u}1]Ít&5< Du뵋U܉$E$EM؍D$U܉Et|EUD$$JE\$$E$P$(U8?U܉$+1ɋUܐt4I u$ fU\$$EUD$$낐t&U$11U&Ud$P&uơT&]9t)T$$u0T&1;P&]u` 1]ÍP&D$T&$z7븐&Ud$؅҉]u}Ë=P&5T&~ND$$2T&D$P&$411-=P&5T&]u}]Ít&D$$1T&D$$P&&2밍t&Ud$ExɺG&؉Et&Ud$Exɺ&؉Et&U1d$qUd$؉u}u }9]t(t$<$:Ét$<$,619‰^]u}` 1]Ð&Ud$T&t8D$$=DT&t1ÐP&1fC1 UWVSd$T&ۋE O؅tCt&Tu *t&҃ t t/uF@T&Tu1ۍv؅u‰\$<$=Du T&P&d$1[^_]ËT&ۉt t t/u!t&뫍҃ ft& t!/t@T&Tuyn+d$1[^_]UVSd$T&ҋE O؉Ѕt7t$T t @T u6@T&u1ҍ[ЅuωT$4$=Dt>d$1[^]À tŀ uKt&T t t@T&u멍v뤡T&P&d$1[^]Kd$1[^]ËT&vUd$$X&$D$T&P&1fUSd$EU xFT&T$$L-T&9t D$$=Du T&P&d$1[]Ív؉Ed$[]&USd$EU xFT&T$$.T&9t D$$W=DT&uP&d$1[]Ð؉Ed$[](&Ud$]uP&9T&NT&f$$T&]u]ÍUSd$UE xNT&D$$$T&9t D$$=DT&uP&d$1[]Ðt&Ed$[]&'USd$ME xnT&tTD$$$$T&9t D$$=Dtd$1[]Ðt&T&P&d$1[]Ðt&d$1[]fEd$[]UUu'&t9PuU PUP1]Ðt&]ÐUW1V1S1ۍd$z@ 5T&$G5@ $Gh Eh T$D$$RE$h Hh v+tVPt&tnbp|D5X&xtZD=X&uv|$4$/5T&h  t4[t&d$,[^_]f=T&Rt&5T&%h \$D$$~Q$d$,[^_]Ð&USd$]|%u!t&t&t u퐍t&[d$1[]fUd$ t7&uDuP&T&1UVSd$5t5$tCuC $Ӎvt$D$$fPd$[^]Í&'Ud$$UPU PUPUP ÍUd$D$ D$D$$-1Ív'Ud$D$ D$D$$U1Ív'Ud$؉]u]u 9}~f؉Ɖt$$|$ t$\$$t$\$D$ $]u}1]Ðt&u]u}1] Ud$ȉuu]}NV~UM$R@ UMv ÉPxH1t4$$$t$C ؋u]}]Ív'UWVSd$]t5$Wƅۉtt&$@t$Ƌud$[^_]Í&ljڐUd$$ }PPÍUd$ h EÍUd$vUVSd$t~i uM]t854$ $$t$c$ku΍d$1[^]Ít&CPDd$1[^][xUd$i Ut= + RE %h UvÍt&USd$h u^d uh 1d$[]Ðt$ $$\$O $Wh {봍t&Ud$t$8t$ %h É'Ud$t$ t3PP$ tÐt&%h ÍUSd$uTt&ctA  th I tHt< uEE1d$[] USd$ Q9|FtD@$D$X Q]d$[]Ívߐ$ Q븐U(;$]Ív'U $(9~.Q)1tI $x&E@]Í)͍E$@ɐU(;$]Ív'UhUxh]É'U $(9S]~AI)1t-t?@R(~ ([]Í)뺍  h  릍'U h E 1]Í&U1 %h ]Ðt&UVSud$]@&$$D$t$tWtAv tPut$믍&h ud$ [^]Ðt&Ed$ [^]É$$y̍&'UWV `S$p $‰1󫍝҉֍JI2)`h\$ EEED$D$R`$D$ $<[^_] USd$hExh!xhd$[]UWVXS$p E$ É1󫍵щۉٍSI )X hCȉt$ D$)E؉U؉D$i@BX)щD$M܍C$wD$TE$D$U$ (9@)9}E=Eu1vp $dÉ$0tD t? t:Et3@Eࡄtġ$/뵐t&1$<[^_]f$<[^_]Í&1EutE$뵍v)1?tD$D$$9 ǀD$D$$ ED$D$$)E|$D$$U.$1t&'USd$  t %h ؍d$[]fu $9(t*@@1=LЉ؉$d$[]Í&ҡt $%u)x ul&% d$[]á$9(t9@@=Mã$ڡ$p $dϐ&UWVSd$]$gƋ=($9ǺtEf@@=M@:u7z@ u.9 [uģ$4$$ud$[^_]$ $kҍ&UWVSd$ċE EԋEeU1ҋUԋu$D$D$U~WxS1ۍ}&t& h @[%h x+9]~&UԉG|$${tUe3u d$<[^_]m'UWVSd$ċM eE1ɋuEEEE1ۍ}Ѓ h @%h x+U܍[T$ \$t$<$t tt2Ue3u2d$<[^_]ÍvEԋU9] E܉UӐt&1Ud$vUd$$ U@@Ð&Ud$衄%h &u,t thÍ$ŐUd$u#t  $u Í&$ÐUWVd$=&F'`%D$$%tvv$t&ơ t4$& 80=u5&t & h   @vD$Ћ5@m %(kED%(E Hf9i ,d$ ^_]Í$ h $uǡh %=1밍E$E(& $Pv6 $P}j  ủEt(Ef+DtE$kDEE&Ea賿vvj  >z $d$ ^_]á&$9uVh h^t&D%`'(4h $4fUSd$] E$& h d$[]UUE t & t&]Í'Ud$TUt, Pt"} t%t-D$ D$$1Í&;HtuD$ D$ $fUd$Eu*8tD$ D$$Í&4u썶'Ud$t!tD$ D$$~ÍUd$ x tXt1tÍu/D$lD$$J$=1ÐD$ D$$1ÍUd$衄%$ D$D1UVSd$&ut;~+1v&[D$ D$$9܍d$1[^]f1ۅ~f%[D$$9d$1[^]fUd$衄%D$E$ÍvUd$衄%D$D$ E D$E$Ít&Ud$؉]ۉu}uu1]u}]Ít&>1 [t݋8ut$$uۋ뷐&USd$@@$D$$8e(D$P$#e,D$ $e0D$ $d<D$ $dDD$ $dHD$ $d@d$[]Í'UWVESd$ԋ} D$ED$T$uu]u5&&~Wá&D$$5l&&&&d$,[^_]Ívۉ&=t$qã&wt&&&$hD$ D$$&&&N& t&&PPt&$txD$ D$$X&5&gZ$n&D&&+&랐5&UWVSd$ċ]p &&&Et $Eԅ۸CiD؁=DP t$ t$ & lW&J&&&^&&&&&&&,0($HL@<D84 PT&&tt1d$<[^_]ËEED$$&&O&hw5 \$U$ 1ۍ}4[|$$u܋&1t&&& $v1ҋ=&l5&&$|Qu ~d$<1[^_]Ív$yPIfED$$&X &J1=&>&^$5&$? #$) Ud$&&E$j1ÍUd$=l]u] ut\~5&~>l&t~+&]&u&]ÅۍC&ٍt&ы]u]f $땉'Ud$cvUd$x uÐt&p $$D$[=DP t{j uي'Ud$p $$D$ ÐUT&X&9‰~T&UtP&9|x]fyT&ףP&]ÐP&]ÍU1T&] UX&T&]1 U1]É'UU9X&|P&1]ÍvU d T&ɸEU;X&P&1]Ít&Ud$P&;X&~P&-ÍtT&T&P&1ÍUd$E|At6T&9)‰ЉT&y T&1ÐT&T&f؉Et&USd$E|pta T&X&~!D1҅u1ҁ=@‰)Ӊ9| T&y X&d$1[]ÐT&-X&֍؉Ed$[]UWVSd$ċE Uҋ}T&ETu E琋E ~ 9X&} \$D$ D$$2jËu/v D$ D$\$$j9„tTáX&t$D$ |$ \$$e}t D$\$$h9„uuÅto)}d$<[^_]Ít& \$D$$gËuYt&m}u&} tIuT&ud$<1[^_]Í&} uڡ D$ D$\$$h뷡 D$\$$uպt&뤍&'Ud$ h @f v%h 1Ð&UVSd$ h @uXÃ%h DZt ӋBAyd$1[^]Í&Ct3Duv \$4$:d$1[^]v tM\$4$qd$1[^]Í&\$4$d$1[^]f\$4$<d$1[^]f\$4$F&\$4$.&Ud$o$\q $D$藁$;pn 1Ð&Ud$d uoUn 1Í&E D$E$n1Ív'Ud$؉uu4$]}} "; }8 t$$X&tE]u}]P$h뾍UWVSd$ԋUu 9~ЉơX&99‰1ۅt$I؉$)EX&)9}ڡ  8  X&R)9 t9E$X& )X&d$,[^_]Ðt&zEt$D$ \$$=뵍t&'UVSd$T&t. @T&tT t t名t& X&9},5 t&@T&9} t t捶9t,D$$T&y T&d$1[^]fT&Ud$؉]]ۉ}u} 5T&;5X&~KVv ||$$T&4$D$5T&1]u}]fd uv tRT&BD$$]u}1]Í|$$\fۋu]}]]BfT&D$ D$ D$$\T&DvUVSd$EU T&# d t,T$$T&$D$1d$[^]Ðt&t5T& BT&t\$$T&;X&t d$1[^]ÍvSDp@tߋ 0tՉ\$4$p$n1b&؉Ed$[^]&T&D$D$ $YT&\$$1 f'Ud$X&UM t;T&tM UF*'v'Ud$X&UM t;T&tM U*v'UWVSd$u>4$ ÉX&; |  @T&9~ t$\$$5u)tfT&D$ T$D$$T&X&T& X&d$[^_]Ðt&1d$[^_]ÍvtzuB T&9t{$褻X&5+J[HJtU1WVSd$} T&`=X&SyT&;X&v T&)ãT&C$薲11~"t& T&@9uT&É$\$cT&D$ D$ |$$qXT&$p4$s4$1d$[^_]+v t?T&T& vT&D$D$ $RVT&D$D$ $/V&sU1d$ȋT&uu}]} u]u}]ÐU؉|$4$T&|$E$9T&|$4$'|$5T&$Q=T&U99|$4$ܸE܋E$D$ʸERE$T&D$E܉$B|$4$5T&E$%ET&E܉$E$]u}1]ÍvUUظT&t&UVSd$D&ۋ5d T&D؅t$tQ :t1$DD$ $d$1[^]Ðt&t$D$$ut$$fUd$؉]}] }uu9~.T&1ۀ>t 4$؋u]}]Ív$|$1 UWVSd$UeE1T&D$4$@ET&UHEEED$$;]EE9} \$$Tv {4$蘷tUU`tu ƀ}DptFI 9}]ET&1Ue3d$l[^_]Éƍt& D$ D$\$$S8UuAEE9CDptWt&EEt&E܉D$ EU)؉$D$ ؉D$PEĉEƃ}4$C4$4;E2U܉D$T$Eˉ$E~D UˉD$T$$S؋]Ev1}EEr4$4$m EEĉ4}H0LUd$Et&'Ud$Et&'Ud$Et&'UWVSd$]eE1ۋ} 5dáX\E`UĉD$ XD$hh`D$Ẻ$ 4KE-`X\1^t<$1Ue39d$L[^_]Í&EUӾC=~ UB$9UE~)]1ӍEӉD$Et$<7$9|]uuEN4$)u܋U$qd10dst&1ۉUB$蛩UDž~,Eאt&EU؍3t$T$$=9}d<$<$1`D$ D$D$hEӉ$5``D5fEEэEщ$1Ut&EӉ$d14t&EUģX\t&hEEӡ`D$ `D$D$i$hX\fUWVSd$ԡT&}E11ۅ~vvE $D$[T& D$$'c9|~7T&D$E$sT&;X&|Ed$,1[^_]@=d uT&D$E$T&;X&}t&D$ 4$T&d$,[^_]Ðt&Ud$EU x7 T&t= HtU E&U Et&؉Et&ÍUd$E ,Ud$ h @]uh ÉЃ࿅ۣh xt\$4$]u]Ít&ߐUSd$j ]t$$D@ 1d$[]Ít&cj u΍d$[]M'Ud$@E(v'UWVSd$ċueE1} v 1 t&[9~Iv tV|$$T&;X&}ɍ[|$$9f胾1Ue3uId$<[^_]Ít&Uԉ$뭍v蓾vƍED$D$<$G&Ud$=HEU tU EUWVd$$Ktg8tbD$$CP \ d$^_]f$ԛt8u$进t 8pD$$.mDM&gt&d$1^_]ÍxI䐐UPLd &]ÍvU1DH@]Ít&'UEH]ÍvUd t1}H1]f15H]Ðt&Ud$$HDE D$1Í&'USd$]t1t$#Ct$]d$[]d$[]É'Ud$|t$|1Ív'Ud$d |t$c|Í&USd$]D$$sCDҡX&P&T&uT&P&d$[]Í&Ud$|t@D$$|P$X&|T&11Í&UWVSd$ԋ $$ $\$E5S ;&E Åt&Ctt9D$$D=tt&۶ ut$#= <$U$j$|$C0 ÅvE5$ED$$}E$d$,[^_]É'Ud$|]ut]u1]Í$ ̟5 É4$|$謟$t$@|@P1]u]Í'UVSd$tI9Xt>5 $\$t$ Ë$Ct$$d$1[^]Ít&'UVSd$] tq=t1`uD$$xu:X&T&DuO=@t T&d$1[^]ÍttX&T&9~DT&tu;T&D£P&d$1[^]ÅtXt&두T&u7 X&t &ۉ]d$[^]&;X&Dǐ&USd$] u d$1[]Ð=tuD$$fxtLttAX&T&9~T&Du7=@yT&1d$[]ËDX&ңT&tɃI;T&D£P&d$1[]f3d$1[]fT&u/X&)t&ۉ]d$[];X&DUSd$] ] Ed$[]LUd$1ÍUd$WPLd &1ÍvU1d$=L@BÐ&Ld EUV%h Ív'Ud$L$PD$]b h @%h Ð&USd$] U@8u xpڀBЃ w> d t LPLd  &d$[]Í-&t =LteTU@%h D$$蘐j t %1uD1딐tkh tp &1td ud 농vd cL &P(t&%L@h Ã%h ST%h @]E d$[]鬏USd$á&u E\$$)d$[]Ð&{SFT$%h d$1[]Ít&'Ud$3u/x.D$&$~ i uÍÐ賡ÍUd$M& h Í&'Ud$%Lj t1Jv'USd$] j u$d$[]t&&\$$L$PD$_d$1[]ÐUE@P&P&P t ]Ðt&U&&]ÐU&]ÍUEx;&t &]1]Ít&U]ÍU&;&u1]Ít&t]É'U&1҉tR&]Í&'U&1;&tR&]Ív'UE+xy 1]Í;&}t]ÐUd$E]u}] |- &9}#t=tx!t 9Xtjt&]u}]Ív1҅E~E R9t!4t9^u}UuEF܍t&MExuUUP듍t&'Ud$$t$Uy1$t$]Í &9}tߋtՋt&t4R9I & Uu &]Ív&]Í&U]ÍUd$$ &P&PP @t@UWVSd$ԋ5tVtP$茾NjC$ v$nEC$`ENj^vuٍd$,[^_]1d$,[^_]É'Ud$ȉ]]ۉ}u} y1]u}]Ðt&;&}$ ¡U4<$׽$$|$耾U~EB<$誽$迓$|$SUBlUVSd$]$ 舓ۉt!$Z$o$\$ËE FFd$[^]Ð&Ud$؉]]ۉu}tGD$$w{1t<$$$|$荽FCF؋u]}]ÍvUd$]]u1t(t$LCt$=s$2]u]ÍUSd$ &~01ۍ&$[9&&&d$[]ÍvUWV1Sd$E=&I9~g)11~![$9=&)xtR1  @9u  &5&5&d$[^_]Ë11Ud$]]ۉutD&~;tFt$ڸ$$'$\$軻F]u]Í&'UVSd$eE1ۋut&;&%&H9WR&$]gD$D$D$ @D$D$?$ڋ R!%tDJD)ڃ$.$\$ºD$4$m &DEe3d$p[^]Í2$&tt$&~ 1&\@9ux@2D$$謎&}w&Ud$Et@t :t1Ít&D$ D$@$=ÐUщWVSˍd$ԉEt&$t$UM^UtYd$,[^_]Ít$$U]*MU]D $u&&>t9(u9t$uf9ƍuЃ<d$,Y[^_]À&t$e1Yvut|$$U蕳U8tV|$$utBE[ \uE| t't[ύ&19t뻉t$$UMMUMEYu<>t&D <-t<<IUWVSÍd$ɉUƒ}M ˆUtEEE1&v3<3~< t< t:j9ƉE)ىE؍PUЋU}t9U} ;uuEE9E~aEЉUM$ƋE؉|$D$4$ӱ}>E}ԋMU4E։Ft&E EuԉUMD$4$EԋMUrvEVEĉEEE}؉uЉωt&v3<3tDU܉D$$uډ}ĉ}؋uЋMĉ+EE؃EEԍd$l[^_]É}؋u֍ 3EEv'U1ɺd$E'UWVSd$ԋU EU؋}$EUtl1ۅt f[u$CDЃ$D9߉U}9~9E~1v$±94$趱Ed$,[^_]fxąx91ɉ]}܋uϐt&[$U诳9ލ|U]֋}܉ $诉E1]܉fD$E؉$,$^9}~9UX DŐt&|;&T&]$,EUd$ȉuE΋E)փ]}ӹw D1U$؈]t$\$$蓮7:D7 UD7T$$G]u}]Ð&UWVSÍd$Uȋ}ȋE eU1ҋ?Eĉ}̍E܉|$MEED$$*}̍<;y;Em]ԋủf}ԍv<7tV;EtN)v t?\u͋UD;E븍U܉<$T$1+~Tt0랍9ű]ucEEuU?FE}ȋUe37Ed$L[^_]Ív?\G}D;E/&+Ẽ$0EԋE119}O}t&}ԍ@9I}0\u|;}u݋}ԍ@9I|֍}̉ʋE]ą,Uĉ "u v'UWVSd$E e M1ɉE̋U : |t1]e3d$L[^_]Ípu։u8*-$C< ?EEe}uȉU$f< tqUԅt9E9u}Ԁ}t3t"< t< Zv3u6=EuU)UB$|Et$\$$蝢D$D$E$~M))D$EL$$TUE$MU$t0=EE]E>9E}E:&uԃE!uEqD$/$訢uԃf< v|$T$$Ev}u ]fM $UE]=uEfND3DM\$L$$}MvEċuԉ$9*v TEԋUt@EԍUԋED$$*t$?=t$(UԋED$$$D$&$U8z111ҋU ]*\909v;50&uȡ9MD$9$Y=M뱀#s}uwED$D$Eĉ$UUԅ"'1ҋ]čI XЀ ?1ۉU}ĐI\PPЀ vU9$SXЀ wU$迢$xM$L$et <-_$IMԋMD$$L$$^$]xH< 171ҋ}čvITPXЀ vO]I\$MD$$$$I<$ 12 < t#< tR<'t|< uٍR܋EԋMăU܉ $T$D$E܋UĉD$EԍD$E1oۉ $\$v*1Ҁ|0&Ra]M$蟞M= HM@ $D$IvEcX $\$2v$v'PtZtS t" t Rt;t1't u'GB'BR'B\B'B'R'B}U$MԋU$MԋU$?x=Yt:ur1$Iø߻$ ڋE$}UM $-E!EԋMt1щU $[uU$T$ǣ1у y'UWVS$dEU Ee M11҉U=|T$tEM $觞uE:} MEE91u}1EUv8%5|8trM8\/"&[v[]4>nYv ULu5|8utD$$|薙|u& \$<$ЅmU|M8ЉMUF EŨ1EEEE1ۉEt6t&G9MU[VE9U֋ME 1MuEE*v |;E;E_}"5}v}8G9MU1[V9U\t&EUM9Mt u4$]u 1}Ue3K$[^_]Ít& t "5}ɐ'\'9[]4>|1M8ЉMu4$>E$s$qU$T$M1-t&1Ʌt4UD2xD$$UxЉ|)$qxML$Eĉ$蛛uĉ4$КÉ9|~؉|)ȋMt$ $cEĉ$X|t&E@$|$pEQE܉4$D$Y\'&gvuD7|D$$xؕ|x؋U<3E[<u"f1҉}]EEEEE׋]fU܍M̈D=EET$ $uv3uŋ}]ŰR!ကtDȍBDɃ+tF9|.9}E||$$qnE|؍M)ЋU‰L$$耙V+EE}'tb}\G9EV\[Enu4$e$zn$t$U1"fUuytp~E|0$t1ɋEVD0<'ExuufR<'YQt<\vuހ|ԍt&G9UM2V[MD1uTG9ЋM@ $|$mE빍G9M+EVE"[:t&D$$u&tUt$$ЅzEUĉD$$MȉEEuąt;>t*4$͖É9q؉t$)E$nuăE4$_1}UȉEE$lEU|BB:Bst$$E9}u|4$x|$kEuċx|FE@$|$kE5f1~ M1|$['['t\u߀|Րt&uЉ|)H $xkuxL$t$Eĉ$>xEDuĉ4$5É9||>&9}u|4$x|$jEuċx|؉|)Et$$萕Eĉ$腒|&U@$|$.jE!U@$|$jEM@ $|$iE9}u|4$|$iEuċ|_EE1&u{MEċu4$觑U9UM $荑0Ud$ȅ]u}t:$袓$i$\$Kt؋u]}]Í$unTatV$VP Ǎ@E$ciÉt$$;/E.his@tory@؋u]}]ÍvE ߗUWVSӍd$ăAED$t$$E5&9NuXEܡ&+]9؉EE~X1EE܋<[$]9]t~,}t݋E܋@$qU̍402 놉׋E|$D$Eԉ$1fxZ<$Eԉ$ߒE؅t E؉$ݎd$<[^_]fE؅t E؉$辎d$<[^_]Ít&띍&u؋t E؉$Eԉ$dd$<[^_]É'Ud$&Et&U1ɉd$UE {t&'U卤$XE]u}D$D$$[tTE\$D$$tHE%=tQ$衑E4$袍E]u}]fEڍt&ۉ$E^t&MUuЃs$?誉E둍vx$芑NjxT$D$$芌E$}rE\9U ~| u &Ct9sÀ; u8 vߍ&ڋ|9 t&C9À; u8 th[]9D$D$4$誉tsE$+ED$ED$x$E<$Qvxt'xtRDPQdt&E믉xtxtRDPtۇEi$YEUWVS$TED$D$$葈xCEt$D$$4t'EUtmPE1!&11EEEEx4$袎t$覊t<$蚊E$[^_]ÍvЃrp$ӎ|Njph|T$D$4$lji4$p!}pMH|9|Mu |x|ȋM 1td&;dv}%9v!~ ux8Ӎvt9ЉxvEˉ t&9Ǎvvy~ Nu9v ~ FtE:$p]ptMp $EpR9U~fxt$ֈ|$ȈE"t&ppF DAF@p蹉pKDH1R]_|1&Ud$D$D$E$ÐUd$]ÅۉuЉ}΋&u]u}]Ít&;t &ɉMt9ωEEuu}t MEщUȉEԃ1UEuEމME)M܉Ӆx]}Uԃ1у9M}}tW+}}t?: ::ty[럀}t MD$L$4$U賍Uủ&M1}t:tCR9|[F}t:uLMT$L$4$[u5&1ET$D$4$UȉM1UȋMuv}C[E;&? Ud$U E&U1ɉd$U Et&'Ud$u]ƋE$E D$E$t"eÉ4$k؋u]]Í&4$KސUVSU E])9؋u|9~(U1 :t'&J: Ru@9[^]Ít&1[^]Ív'Ud$ȉ}}u<$u ]2y]u}]Ít&9|1ۅuE}t&SD9]~`U)څt<|$ T$D$$Pwą[tG빍D$T$$܋fu)S󐍴&UVSd$]u $Yt-t$ D$\$$mt(t#d$[^]ÍvD$D$$dftFʍ'Ud$ȉu}u }E]D$4$Y~#UEUD$$U;U~9t1]u}]Ð:ut=M DM}:D9uи&^vJR8u@9UWVSd$ċu4$EeE1EM 9E EU E1ۉEЉt&]ԍ9] ~UEЍU)؉T$ D$D$E؉$ƍ@vAt%EtE؉$Éu9] &Ue3Eu2d$<[^_]EE]Ծpt&E誆v'Ud$eE1]u] uu4$P9|Ue3uD]u])؍UD$EED$T$ E$wEUW1VSd$ċEEԋE eU1҅uEEIUԍE܉|$D$$89~ fv~Y}߉<$,tHU܉D$T$ E؉|$$>PvNt"MtE؉$vUuAUe3d$<[^_]Í[vEEb&uԍ}މ4$舂D$U܉t$T$ 5&E؉$蕇u3uމ4$QD$U܉t$T$ <$jƍ@vR薄Ud$ȅ]u}É։tF8tA$4>4$EUD$WU1t+\$<$腂E4>4$赁$W1t$$W]u}]Ð&U1WVSd$ԋ];~C4$iÉ4$R$}U‰U܃9UUEUE؉U\$$h~$R#vEU9UbUE}}</]LMЅAEȋ}8Eȍd$L[^_]Í1E]fE}9}]CEЋ}̍|8}̉D$Eȉ$RE1}̍|}̉D$Eȉ$aREMEV1}MŰẺ$REUU~]É'U卤$( d ɉu]}u u uEt$$跦1]u}]Ét$$蘦D]T& t})qDžL[x1DžT׉P4v4$t$HzwHt(TtIxt 19t$uu9P;Lt븃T1뭍`T p $ uǡp $tWHЃ)` Cȋ=T&T&)‰Ui@B)щMDED$ D$D$t$$|=T&1WT1DžL(DžL{Ud$EuZD$D$@ $)D$D$@ $]D$D$@ $}Ít&D$D$^$)D$D$^$]D$D$^$}dÐUWVd$M u}ɋUu}EuEuUu9v8щ1 f9vL11ɉȋMɉt؃ڍd$ ^_]Íu 1ƋM1lj뾍ЃUuE;uv9s1뛍vڋuEمT]UU]Bt&ME +E UMUUuM ׉u։e9։Ur MU9s;ut1t&O1UWVd$ЋM u}ɋUu}EuE}}܍uUЉU؉u+9Mv~Љu܋EԉFuEUd$0^_]Ð9v$NEԅtEU؃ڍd$0^_]ÍvЃUuuM9M9M؉~븍&U܅u 1u܉E܉1u܋Eucf]U].Et&M¸ +EEM؋E ЉMEȋEM؉E̋EMMM }uȉ}܉e9rF9Er=M)׉ʉMMM Љ~t&U+UljU9u+EU뷐UWVd$EUuU} u49w`u 1ƋM1҉ljȍd$^_]Ít&9wЃUu9;u911ɉȉd$^_]Éщ1ȍd$^_]ME +E UMUUuM ׉u։e9։Ur0MU9s;ut1qt&1`t&O1ȉd$^_]ÐUWVd$UMҋ}ȉMu u9vF1ҍd$^_]Í9wLʃMuQ;}E)։EEd$^_]Ðu 1lj1E뢍t&ȉd$^_]Ít&MU +UUM UMUM}MM MЉue9r19r)M)MM d$^_]Ðt&9u+EUˍt&9&U]ff.UWVSOù*Gm)t$1ED$E D$E$9rރ[^_]Ë$ÐUSd$t[Ћud$[]ÐUS[,*yY[I have no name!rbashBASH_ENVGNU bash, version %s-(%s) i386-redhat-linux-gnuGNU long options: --%s Shell options: -%s or -o option ??host??run_one_command-cFUNCNAMEBASH_SOURCEBASH_LINENOmain%s: is a directoryPOSIXLY_CORRECTPOSIX_PEDANTIC\s-\v\$ > ~/.bashrc%s: invalid option%c%c: invalid optionlogin_shellEMACSemacsdumbetermPS1PS2SSH_CLIENTSSH2_CLIENT/etc/profile~/.profile~/.bash_profile~/.bash_logindebuggerdump-po-stringsdump-stringshelpnoeditingnoprofilenorcposixprotectedrcfilerpm-requiresUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -irsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. %s: cannot execute binary file/usr/share/bashdb/bashdb-main.inccannot start debugger; debugging mode disabled%s: option requires an argument000000000000000000000000000000000000000o000cĻxiDiii\LiiHii|iTiPiLidǼLtimed out waiting for input: auto-logout PROMPT_COMMAND/%s TMOUTreader_loopPIPESTATUS ; readline stdincommand substitution%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOME ;|&syntax error near `%s'syntax erroresacevalletUse "%s" to leave the shell. "$@"COPROCmemory exhaustedexpected `)'=~-nthenelseeliffiforselectwhileuntildone[[coproc-p&&||<&>&;;;;&<<-<<<&>&>>>|ooT@$/#\"L#s#\"\"\"\"\"\"\"\"\"\"\"########\"\"\"\"\"\"\"\"%%\"\"W$\"\"\"`%\"\"\"\"\"\"\"\"\"\"\"%\"&&\"\"\"'6('\"\"\"6(\"\"%6(\"\"`%\"'\"'\"'\"\"\"6("(%"&&iuМ:~՟SјTיUؚ`1N֑TגZؓ[ޔ\1|JƗߗ 6=Dhov}τք݄{g݆Wч#u>mYӋM,b΍ՍG;hޏ/Zݐ'/?+:QvƠ٤x1]dn)33DKRižNU_ {();&| &'(   6,),,E(,,KXjTw,,,,,,,,,,,,,,,,,,<U,g,,,$.\, ,,,,,,,,,,,,,,,,,,,,,,,,,,,\,,,,,,,$,,1,,,,3,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,\\++,,,,,,&,v,/L,,)+,,,,,,,54,,,0,,,,,,,,;,,,GS,,,```,,,,:,,DO&,,,i,V-X<,$,,,,,,,,,T,,,l,,,,,,t,,,,,k=,,,,,lC,,oF,,,,,20:;7165849  !"#$%&'()*+,-./3 ' > E%<=?{|B/4442 !;;E D27: C7 H2yz2}~u8:1232882:2288:88223: !?@ !2 !801{|722882123871177123:;7'()"#$%& *+,-.+56"#$%&7*+,-.9?@56'()$"#$%&+*/0-.;97;56;<A  !99012"#$%&9*+,-.923568: 9999 6"#$%& *+,-.123568: "#$%&*+,-.2568: "#$%&*+,-.568: "#$%&*+,-.568: "#$%&*+,-.2568: "#$%&*+,-.568: "#$%&*+,-.568:"#$%&*-.56@AEtGs5}*<*~8op+7?atbsB" Fc =(> !IJ_ !evwf`tyz/IJ;yz?d{|55ghijk0l<A@mtnq 55   r.5:D%&'6KLMNO9P=>QRCSTEFK  ! # $,-1238 !4H GLMNO DB )H !  !  !  !  !  ! C !UVWXYZ[\]^45o69;<@JDA>F?EGHI4jf& /)#,23 4:7=hgp("1+%. '!0*$- ne8cbiktUVBCd`m_z|~u]KLWXal{}^MNSTYZqvwsxyQRrOP[\  <====>>????????????????????????????????????????????@@@AABBCCCCCDDDDDDDDDDDEEEEEEEEFFFFGGGGGGHHHIIIJJKLLLLLMMMNOPQQQRRSSSSTTTTTTUUVWWXXXYYYYYYZZ[[[\\]]]^^^^^______```aa,,},,,,,,-,,,,,,Q,,}9,4,,"#$u%&'()*+,-./0129:x;3467syntax error near unexpected token `%s'syntax error: unexpected end of fileunexpected EOF while looking for matching `%c'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected EOF while looking for matching `)'unexpected token `%s', expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operatorunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional command:~OLDPWD/dev/tty`%s': not a valid identifierPROMPT_DIRTRIMgetcwd: cannot access parent directoriesX%s(%s) clean_simple_commandexecutablesyntax error: `;' unexpectedsyntax error: `((%s))'make_redirection: redirection instruction `%d' out of rangemake_here_document: bad instruction type %dhere-document at line %d delimited by end-of-file (wanted `%s')syntax error: arithmetic expression requiredabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ(@@X((X%u! ) && || [[ case %s in select %s in for %s in {%s}<<%s%s>|%s>> %s<> %s<<< %s{%s}<&%d%d<&%d{%s}>&%d%d>&%d{%s}<&%s%d<&%s{%s}>&%s%d>&%s{%s}<&%d-%d<&%d-{%s}>&%d-%d>&%d-{%s}<&%s-%d<&%s-{%s}>&%s-%d>&%s-{%s}>&-%d>&-&>%s&>>%stime -p for (( | if then else function %s () { } { coproc %s print_command do () PS4(( )) '' ]] case %s in ''%s%s=(%s) xtrace_set: NULL file pointercprintf: `%c': invalid format characterprint_command: bad connector `%d'xtrace_set: %d: invalid file descriptorxtrace fd (%d) != fileno xtrace fp (%d)HP0Hp(P@(ph`dispose_commandP@pPcannot duplicate fd %d to fd %dcannot redirect standard input from /dev/null: %s%s: restricted: cannot specify `/' in command namesexecute_coproc: coproc [%d:%s] still existsTIMEFORMAT: `%c': invalid format character%s_PID/dev/nulleval_builtinbuiltin_envreturn_temp_envexecute_cond_node%s: readonly function%s: %s: bad interpreterELF.interp%s: %s: bad ELF interpretersimple-commandfgbgauto_resumeexactsubstringsaved redirectssaved_redirectscommand_not_found_handle%s: command not foundloop_redirectionsexecute_commandPS3#? LINESCOLUMNS%*d%s%sfunction_callingexecute-shell-functionreal %2R user %2U sys %2S real %3lR user %3lU sys %3lSpipe errorpipe-file-descriptorsexecute_connection&?\>=> ><<y<c<A<;::9|?d pop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables context%s: %s: invalid value for trace file descriptorpop_scope: head of shell_variables not a temporary environment scopemake_local_variable: no function context at current scopeshell level (%d) too high, resetting to 1error importing function definition for `%s'all_local_variables: no function context at current scope%s: %s: cannot open as FILEIFSBASH_ARGVBASH_ARGC_=OPTERRCOMP_WORDBREAKSGLOBIGNOREOPTINDignorespaceignoredupsignorebotherasedupsHISTFILE%s=PPIDshell-initSHLVLBASH_FUNC_() {/usr/local/bin:/bin:/usr/bin+ i386HOSTTYPEOSTYPEMACHTYPEHOSTNAME60600MAILCHECKBASHBASH_VERSIONBASH_VERSINFOBASH_EXECUTION_STRING~/.bash_history~/.sh_historyIGNOREEOFignoreeofHISTCONTROLHISTIGNOREHISTTIMEFORMATEUIDSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMBASHPIDHISTCMDDIRSTACKGROUPSBASH_CMDSBASH_ALIASESBASH_XTRACEFDHISTFILESIZEHISTSIZEHOSTFILELANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICLC_TIMEMAILMAILPATHTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRTZhistchars h  xH8@p(null)last command: %s Aborting...%s: %s: %d%s: line %s: %s:%s%d: warning: %s: readonly variable%s: unbound variablebash-maintainers@gnu.orgunknown command errorbad command typebad connectorbad jump;Tj{division by 0bug: bad expassign tokensyntax error in expressionrecursion stack underflowinvalid numberinvalid arithmetic basevalue too great for base*/%+-&^|missing `)'exponent less than 0expression expected%s%s%s: %s (error token is "%s")attempted assignment to non-variableexpression recursion level exceededsyntax error: operand expectedsyntax error: invalid arithmetic operatoridentifier expected after pre-increment or pre-decrement`:' expected for conditional expressiontgJ4a(b,e0f4hiXk8mTn<plrdt@uHvLxPBCDEtHI`P\TpSignal %d[%d]%c |%5ldDoneStoppedStopped(%s)RunningDone(%d)Exit %dUnknown status%*s(core dumped) & (wd: %s) [%d] %ld SIGCHLD trap[%ld: %d (%d)] tcsetattrno job control in this shellstart_pipeline: pgrp pipefork: retryforkchild setpgid (%ld to %ld)%s: line %d: (core dumped)(wd now: %s) notify_of_job_statusjob-working-directory%s: job has terminated[%d]%s (wd: %s)describe_pid: %ld: no such pidinitialize_job_control: getpgrp failedinitialize_job_control: setpgidcannot set terminal process group (%d)deleting stopped job %d with process group %ldadd_process: pid %5ld (%s) marked as still aliveforked pid %d appears in running job %dwaitchld: turning on WNOHANG to avoid indefinite blockwait_for: No record of process %ld%s: job %d already in backgroundwait_for_job: job %d is stoppedwait: pid %ld is not a child of this shellWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWXPX6X6X6X6X6X6X6X6XVXPX6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6XVXPX6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6X6XVX`X r E + r r r r r r r r " r r r r r r r r r r r r r r r r r  X  x     (     P   p p p p p p p p p p                                                                   $($[>(<(/dev/fd/process substitution-Ano match: %s#%^,~:-=?+/}#%:-=?+/}%:=+/%s: substring expression < 0%s: bad substitution%s: parameter null or not setcannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1%s: cannot assign list to array memberbad substitution: no closing `%s' in %scannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dbad substitution: no closing "`" in %s$%s: cannot assign in this wayYou have mail in $_You have new mail in $_The mail in %s has been read interrupt trapreturn traperror trapdebug trapexit trapinvalid signal numbertrap_handler: bad signal %dSIGEXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGSTKFLTSIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMIN+15SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNrun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselfcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %dcannot reset nodelay mode for fd %d@b  b  b  b  b  b  b  b  b 8b @b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b 8b @b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b  b 8b 8b 8b c b b b c c c c b b c b b b b b b b b b b b b b b b b c b b b b b b b b b b b b b b b b b b b b b b b b b b b c c b c b b b b b b b b b b b b b b b b b b b b b b b b b b b b c c argument expected%s: unary operator expected%s: binary operator expected`)' expected`)' expected, found %smissing `]'too many arguments%s: integer expression expectedw {t {t {t {t w {t Xw 0w {t {t {t w {t {t {t {t {t {t {t {t {t {t {t {t {t v v v Pv v v u w {t {t u {t {t u u pu {t `u 0u t t {t t t {t t (| | { { { H| X 8    release4.1%s.%d(%d)-%sGNU bash, version %s (%s) Copyright (C) 2009 Free Software Foundation, Inc.License GPLv3+: GNU GPL version 3 or later This is free software; you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. @(#)Bash version 4.1.2(1) release GNUرб8 ;|&( ;|&()'()'bad array subscript%s[%s: %s[%s]: %sarray assign%s: invalid associative array key%s: cannot assign to non-numeric index%s: %s: must use subscript when assigning associative array%s: cannot convert indexed to associative array^%0*d,%s%s%s%s: cannot create: %s500%s: first non-whitespace character is not `"'bash_execute_unix_command: cannot find keymap for commandfc -e "${VISUAL:-${EDITOR:-vi}}"fc -e "${VISUAL:-${EDITOR:-emacs}}"no closing `%c' in %s%s: missing colon separator READLINE_LINEREADLINE_POINTbash_execute_unix_command$@completion-ignore-case;|&{(`$include hostname_completion_file/etc/hostssymlink-hook()<>;&| _EmptycmD_Bashshell-expand-linehistory-expand-linemagic-spaceshell-forward-wordshell-backward-wordshell-kill-wordshell-backward-kill-wordhistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-historydabbrev-expand'" \"'@<>=;|&()#$`?*[!:{~%s %dinput-metaC-xC-efc -e vi "'#comment-beginFIGNORE "'@><=;|&(: "'><=;|&(:ǸָPOSIX"" /usr/share/locale#: %s:%d msgid %s%s msgstr "" setlocale: LC_ALL: cannot change locale (%s)setlocale: LC_ALL: cannot change locale (%s): %ssetlocale: %s: cannot change locale (%s)setlocale: %s: cannot change locale (%s): %sredirection error: cannot duplicate fd%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here-document: %s%s: cannot assign fd to variablefile descriptor out of range%s: ambiguous redirectsh-thd/dev/tcp/*/*/dev/udp/*/*hn (n n m n r r r r (q (q p p (q o r r r po po p p po po r COMP_LINECOMP_POINTCOMP_TYPECOMP_KEYCOMP_WORDSCOMP_CWORDgen-shell-function-matchesCOMPREPLY_DefaultCmD_completion: function `%s' not foundprogrammable_completion: %s: possible retry loopprogcomp_insert: %s: NULL COMPSPEC%s: cannot allocate %lu bytes (%lu bytes allocated)xreallocxmallocunaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [expr]cd [-L|-P] [dir]pwdpwd [-LP]truefalsedeclaretypesetlocalecho [-neE] [arg ...]enableeval [arg ...]getoptsgetopts optstring name [arg]exit [n]logout [n]fg [job_spec]bg [job_spec ...]help [-dms] [pattern ...]disownlet arg [arg ...]readreturn [n]unset [-f] [-v] [name ...]readonlyshiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [id]time [-p] pipeline{ ... }{ COMMANDS ; }%job_spec [&](( ... ))(( expression ))[[ ... ]][[ expression ]]pushdpushd [-n] [+N | -N | dir]popdpopd [-n] [+N | -N]dirs [-clpv] [+N] [-N]shoptprintfcompgencompoptmapfilereadarrayalias [-p] [name[=value] ... ]bind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-aAfFilrtux] [-p] [name[=value] ...]typeset [-aAfFilrtux] [-p] name[=value] ...local [option] name[=value] ...enable [-a] [-dnps] [-f filename] [name ...]exec [-cl] [-a name] [command [arguments ...]] [redirection ...]fc [-e ename] [-lnr] [first] [last] or fc -s [pat=rep] [command]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -anrw [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ...]kill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]read [-ers] [-a array] [-d delim] [-i text] [-n nchars] [-N nchars] [-p prompt] [-t timeout] [-u fd] [name ...]set [--abefhkmnptuvxBCHP] [-o option-name] [arg ...]export [-fn] [name[=value] ...] or export -preadonly [-af] [name[=value] ...] or readonly -ptrap [-lp] [[arg] signal_spec ...]ulimit [-SHacdefilmnpqrstuvx] [limit]for NAME [in WORDS ... ] ; do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donecoproc [NAME] command [redirections]function name { COMMANDS ; } or name () { COMMANDS ; }variables - Names and meanings of some shell variablesshopt [-pqsu] [-o] [optname ...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-DE] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [word]compopt [-o|+o option] [-DE] [name ...]mapfile [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]readarray [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]Define or display aliases. Without arguments, `alias' prints the list of aliases in the reusable form `alias NAME=VALUE' on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Options: -p Print all defined aliases in a reusable format Exit Status: alias returns true unless a NAME is supplied for which no alias has been defined.Remove each NAME from the list of defined aliases. Options: -a remove all alias definitions. Return success unless a NAME is not an existing alias.Set Readline key bindings and variables. Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: e.g., bind '"\C-x\C-r": re-read-init-file'. Options: -m keymap Use KEYMAP as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input. -V List variable names and values -v List variable names and values in a form that can be reused as input. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -r keyseq Remove the binding for KEYSEQ. -f filename Read key bindings from FILENAME. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. Exit Status: bind returns 0 unless an unrecognized option is given or an error occurs.Exit for, while, or until loops. Exit a FOR, WHILE or UNTIL loop. If N is specified, break N enclosing loops. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Resume for, while, or until loops. Resumes the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resumes the Nth enclosing loop. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Execute shell builtins. Execute SHELL-BUILTIN with arguments ARGs without performing command lookup. This is useful when you wish to reimplement a shell builtin as a shell function, but need to execute the builtin within the function. Exit Status: Returns the exit status of SHELL-BUILTIN, or false if SHELL-BUILTIN is not a shell builtin..Return the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0. Exit Status: Returns 0 unless the shell is not executing a shell function or EXPR is invalid.Change the shell working directory. Change the current directory to DIR. The default DIR is the value of the HOME shell variable. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, the word is assumed to be a variable name. If that variable has a value, its value is used for DIR. Options: -L force symbolic links to be followed -P use the physical directory structure without following symbolic links The default is to follow symbolic links, as if `-L' were specified. Exit Status: Returns 0 if the directory is changed; non-zero otherwise.Print the name of the current working directory. Options: -L print the value of $PWD if it names the current working directory -P print the physical directory, without any symbolic links By default, `pwd' behaves as if `-L' were specified. Exit Status: Returns 0 unless an invalid option is given or the current directory cannot be read.Null command. No effect; the command does nothing. Exit Status: Always succeeds.Return a successful result. Exit Status: Always succeeds.Return an unsuccessful result. Exit Status: Always fails.Execute a simple command or display information about commands. Runs COMMAND with ARGS suppressing shell function lookup, or display information about the specified COMMANDs. Can be used to invoke commands on disk when a function with the same name exists. Options: -p use a default value for PATH that is guaranteed to find all of the standard utilities -v print a description of COMMAND similar to the `type' builtin -V print a more verbose description of each COMMAND Exit Status: Returns exit status of COMMAND, or failure if COMMAND is not found.Set variable values and attributes. Declare variables and give them attributes. If no NAMEs are given, display the attributes and values of all variables. Options: -f restrict action or display to function names and definitions -F restrict display to function names only (plus line number and source file when debugging) -p display the attributes and value of each NAME Options which set attributes: -a to make NAMEs indexed arrays (if supported) -A to make NAMEs associative arrays (if supported) -i to make NAMEs have the `integer' attribute -l to convert NAMEs to lower case on assignment -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -u to convert NAMEs to upper case on assignment -x to make NAMEs export Using `+' instead of `-' turns off the given attribute. Variables with the integer attribute have arithmetic evaluation (see the `let' command) performed when the variable is assigned a value. When used in a function, `declare' makes NAMEs local, as with the `local' command. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Set variable values and attributes. Obsolete. See `help declare'.Define local variables. Create a local variable called NAME, and give it VALUE. OPTION can be any option accepted by `declare'. Local variables can only be used within a function; they are visible only to the function where they are defined and its children. Exit Status: Returns success unless an invalid option is supplied, an error occurs, or the shell is not executing a function.Write arguments to the standard output. Display the ARGs on the standard output followed by a newline. Options: -n do not append a newline -e enable interpretation of the following backslash escapes -E explicitly suppress interpretation of backslash escapes `echo' interprets the following backslash-escaped characters: \a alert (bell) \b backspace \c suppress further output \e escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits \xHH the eight-bit character whose value is HH (hexadecimal). HH can be one or two hex digits Exit Status: Returns success unless a write error occurs.Enable and disable shell builtins. Enables and disables builtin shell commands. Disabling allows you to execute a disk command which has the same name as a shell builtin without using a full pathname. Options: -a print a list of builtins showing whether or not each is enabled -n disable each NAME or display a list of disabled builtins -p print the list of builtins in a reusable format -s print only the names of Posix `special' builtins Options controlling dynamic loading: -f Load builtin NAME from shared object FILENAME -d Remove a builtin loaded with -f Without options, each NAME is enabled. To use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. Exit Status: Returns success unless NAME is not a shell builtin or an error occurs.Execute arguments as a shell command. Combine ARGs into a single string, use the result as input to the shell, and execute the resulting commands. Exit Status: Returns exit status of command or success if command is null.Parse option arguments. Getopts is used by shell procedures to parse positional parameters as options. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters ($0 - $9), but if more arguments are given, they are parsed instead. Exit Status: Returns success if an option is found; fails if the end of options is encountered or an error occurs.Replace the shell with the given command. Execute COMMAND, replacing this shell with the specified program. ARGUMENTS become the arguments to COMMAND. If COMMAND is not specified, any redirections take effect in the current shell. Options: -a name pass NAME as the zeroth argument to COMMAND -c execute COMMAND with an empty environment -l place a dash in the zeroth argument to COMMAND If the command cannot be executed, a non-interactive shell exits, unless the shell option `execfail' is set. Exit Status: Returns success unless COMMAND is not found or a redirection error occurs.Exit the shell. Exits the shell with a status of N. If N is omitted, the exit status is that of the last command executed.Exit a login shell. Exits a login shell with exit status N. Returns an error if not executed in a login shell.Display or execute commands from the history list. fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. Options: -e ENAME select which editor to use. Default is FCEDIT, then EDITOR, then vi -l list lines instead of editing -n omit line numbers when listing -r reverse the order of the lines (newest listed first) With the `fc -s [pat=rep ...] [command]' format, COMMAND is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command. Exit Status: Returns success or status of executed command; non-zero if an error occurs.Move job to the foreground. Place the job identified by JOB_SPEC in the foreground, making it the current job. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Status of command placed in foreground, or failure if an error occurs.Move jobs to the background. Place the jobs identified by each JOB_SPEC in the background, as if they had been started with `&'. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Returns success unless job control is not enabled or an error occurs.Remember or display program locations. Determine and remember the full pathname of each command NAME. If no arguments are given, information about remembered commands is displayed. Options: -d forget the remembered location of each NAME -l display in a format that may be reused as input -p pathname use PATHNAME is the full pathname of NAME -r forget all remembered locations -t print the remembered location of each NAME, preceding each location with the corresponding NAME if multiple NAMEs are given Arguments: NAME Each NAME is searched for in $PATH and added to the list of remembered commands. Exit Status: Returns success unless NAME is not found or an invalid option is given.Display information about builtin commands. Displays brief summaries of builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise the list of help topics is printed. Options: -d output short description for each topic -m display usage in pseudo-manpage format -s output only a short usage synopsis for each topic matching PATTERN Arguments: PATTERN Pattern specifiying a help topic Exit Status: Returns success unless PATTERN is not found or an invalid option is given.Display or manipulate the history list. Display the history list with line numbers, prefixing each modified entry with a `*'. An argument of N lists only the last N entries. Options: -c clear the history list by deleting all of the entries -d offset delete the history entry at offset OFFSET. -a append history lines from this session to the history file -n read all history lines not already read from the history file -r read the history file and append the contents to the history list -w write the current history to the history file and append them to the history list -p perform history expansion on each ARG and display the result without storing it in the history list -s append the ARGs to the history list as a single entry If FILENAME is given, it is used as the history file. Otherwise, if $HISTFILE has a value, that is used, else ~/.bash_history. If the $HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise. Exit Status: Returns success unless an invalid option is given or an error occurs.Display status of jobs. Lists the active jobs. JOBSPEC restricts output to that job. Without options, the status of all active jobs is displayed. Options: -l lists process IDs in addition to the normal information -n list only processes that have changed status since the last notification -p lists process IDs only -r restrict output to running jobs -s restrict output to stopped jobs If -x is supplied, COMMAND is run after all job specifications that appear in ARGS have been replaced with the process ID of that job's process group leader. Exit Status: Returns success unless an invalid option is given or an error occurs. If -x is used, returns the exit status of COMMAND.Remove jobs from current shell. Removes each JOBSPEC argument from the table of active jobs. Without any JOBSPECs, the shell uses its notion of the current job. Options: -a remove all jobs if JOBSPEC is not supplied -h mark each JOBSPEC so that SIGHUP is not sent to the job if the shell receives a SIGHUP -r remove only running jobs Exit Status: Returns success unless an invalid option or JOBSPEC is given.Send a signal to a job. Send the processes identified by PID or JOBSPEC the signal named by SIGSPEC or SIGNUM. If neither SIGSPEC nor SIGNUM is present, then SIGTERM is assumed. Options: -s sig SIG is a signal name -n sig SIG is a signal number -l list the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and allows processes to be killed if the limit on processes that you can create is reached. Exit Status: Returns success unless an invalid option is given or an error occurs.Evaluate arithmetic expressions. Evaluate each ARG as an arithmetic expression. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. Exit Status: If the last ARG evaluates to 0, let returns 1; let returns 0 otherwise..Read a line from the standard input and split it into fields. Reads a single line from the standard input, or from file descriptor FD if the -u option is supplied. The line is split into fields as with word splitting, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with any leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. Options: -a array assign the words read to sequential indices of the array variable ARRAY, starting at zero -d delim continue until the first character of DELIM is read, rather than newline -e use Readline to obtain the line in an interactive shell -i text Use TEXT as the initial text for Readline -n nchars return after reading NCHARS characters rather than waiting for a newline, but honor a delimiter if fewer than NCHARS characters are read before the delimiter -N nchars return only after reading exactly NCHARS characters, unless EOF is encountered or read times out, ignoring any delimiter -p prompt output the string PROMPT without a trailing newline before attempting to read -r do not allow backslashes to escape any characters -s do not echo input coming from a terminal -t timeout time out and return failure if a complete line of input is not read withint TIMEOUT seconds. The value of the TMOUT variable is the default timeout. TIMEOUT may be a fractional number. If TIMEOUT is 0, read returns success only if input is available on the specified file descriptor. The exit status is greater than 128 if the timeout is exceeded -u fd read from file descriptor FD instead of the standard input Exit Status: The return code is zero, unless end-of-file is encountered, read times out, or an invalid file descriptor is supplied as the argument to -u.Return from a shell function. Causes a function or sourced script to exit with the return value specified by N. If N is omitted, the return status is that of the last command executed within the function or script. Exit Status: Returns N, or failure if the shell is not executing a function or script.Set or unset values of shell options and positional parameters. Change the value of shell attributes and positional parameters, or display the names and values of shell variables. Options: -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the Posix standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not follow symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG trap is inherited by shell functions. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed. Exit Status: Returns success unless an invalid option is given.Unset values and attributes of shell variables and functions. For each NAME, remove the corresponding variable or function. Options: -f treat each NAME as a shell function -v treat each NAME as a shell variable Without options, unset first tries to unset a variable, and if that fails, tries to unset a function. Some variables cannot be unset; also see `readonly'. Exit Status: Returns success unless an invalid option is given or a NAME is read-only.Set export attribute for shell variables. Marks each NAME for automatic export to the environment of subsequently executed commands. If VALUE is supplied, assign VALUE before exporting. Options: -f refer to shell functions -n remove the export property from each NAME -p display a list of all exported variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Mark shell variables as unchangeable. Mark each NAME as read-only; the values of these NAMEs may not be changed by subsequent assignment. If VALUE is supplied, assign VALUE before marking as read-only. Options: -a refer to indexed array variables -A refer to associative array variables -f refer to shell functions -p display a list of all readonly variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Shift positional parameters. Rename the positional parameters $N+1,$N+2 ... to $1,$2 ... If N is not given, it is assumed to be 1. Exit Status: Returns success unless N is negative or greater than $#.Execute commands from a file in the current shell. Read and execute commands from FILENAME in the current shell. The entries in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed. Exit Status: Returns the status of the last command executed in FILENAME; fails if FILENAME cannot be read.Suspend shell execution. Suspend the execution of this shell until it receives a SIGCONT signal. Unless forced, login shells cannot be suspended. Options: -f force the suspend, even if the shell is a login shell Exit Status: Returns success unless job control is not enabled or an error occurs.Evaluate conditional expression. Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators as well, and numeric comparison operators. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2. Exit Status: Returns success if EXPR evaluates to true; fails if EXPR evaluates to false or an invalid argument is given.Evaluate conditional expression. This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Display process times. Prints the accumulated user and system times for the shell and all of its child processes. Exit Status: Always succeeds.Trap signals and other events. Defines and activates handlers to be run when the shell receives signals or other conditions. ARG is a command to be read and executed when the shell receives the signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed before every simple command. If no arguments are supplied, trap prints the list of commands associated with each signal. Options: -l print a list of signal names and their corresponding numbers -p display the trap commands associated with each SIGNAL_SPEC Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. A signal may be sent to the shell with "kill -signal $$". Exit Status: Returns success unless a SIGSPEC is invalid or an invalid option is given.Display information about command type. For each NAME, indicate how it would be interpreted if used as a command name. Options: -a display all locations containing an executable named NAME; includes aliases, builtins, and functions, if and only if the `-p' option is not also used -f suppress shell function lookup -P force a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed -p returns either the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file'. -t output a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or not found, respectively Arguments: NAME Command name to be interpreted. Exit Status: Returns success if all of the NAMEs are found; fails if any are not found.Modify shell resource limits. Provides control over the resources available to the shell and processes it creates, on systems that allow such control. Options: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -b the socket buffer size -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Display or set file mode mask. Sets the user file-creation mask to MODE. If MODE is omitted, prints the current value of the mask. If MODE begins with a digit, it is interpreted as an octal number; otherwise it is a symbolic mode string like that accepted by chmod(1). Options: -p if MODE is omitted, output in a form that may be reused as input -S makes the output symbolic; otherwise an octal number is output Exit Status: Returns success unless MODE is invalid or an invalid option is given.Wait for job completion and return exit status. Waits for the process identified by ID, which may be a process ID or a job specification, and reports its termination status. If ID is not given, waits for all currently active child processes, and the return status is zero. If ID is a a job specification, waits for all processes in the job's pipeline. Exit Status: Returns the status of ID; fails if ID is invalid or an invalid option is given.Execute commands for each member in a list. The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed. Exit Status: Returns the status of the last command executed.Arithmetic for loop. Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1. Exit Status: Returns the status of the last command executed.Select words from a list and execute commands. The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed. Exit Status: Returns the status of the last command executed.Report time consumed by pipeline's execution. Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. Options: -p print the timing summary in the portable Posix format The value of the TIMEFORMAT variable is used as the output format. Exit Status: The return status is the return status of PIPELINE.Execute commands based on pattern matching. Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns. Exit Status: Returns the status of the last command executed.Execute commands based on conditional. The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true. Exit Status: Returns the status of the last command executed.Execute commands as long as a test succeeds. Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero. Exit Status: Returns the status of the last command executed.Execute commands as long as a test does not succeed. Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero. Exit Status: Returns the status of the last command executed.Create a coprocess named NAME. Execute COMMAND asynchronously, with the standard output and standard input of the command connected via a pipe to file descriptors assigned to indices 0 and 1 of an array variable NAME in the executing shell. The default NAME is "COPROC". Exit Status: Returns the exit status of COMMAND.Define shell function. Create a shell function named NAME. When invoked as a simple command, NAME runs COMMANDs in the calling shell's context. When NAME is invoked, the arguments are passed to the function as $1...$n, and the function's name is in $FUNCNAME. Exit Status: Returns success unless NAME is readonly.Group commands as a unit. Run a set of commands in a group. This is one way to redirect an entire set of commands. Exit Status: Returns the status of the last command executed.Resume job in foreground. Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'. Exit Status: Returns the status of the resumed job.Evaluate arithmetic expression. The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to "let EXPRESSION". Exit Status: Returns 1 if EXPRESSION evaluates to 0; returns 0 otherwise.Execute conditional command. Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators: ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. When the `=~' operator is used, the string to the right of the operator is matched as a regular expression. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value. Exit Status: 0 or 1 depending on value of EXPRESSION.Common shell variable names and usage. BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directories given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Add directories to stack. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. Options: -n Suppresses the normal change of directory when adding directories to the stack, so only the stack is manipulated. Arguments: +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. dir Adds DIR to the directory stack at the top, making it the new current working directory. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Remove directories from stack. Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and changes to the new top directory. Options: -n Suppresses the normal change of directory when removing directories from the stack, so only the stack is manipulated. Arguments: +N Removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N Removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Display directory stack. Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. Options: -c clear the directory stack by deleting all of the elements -l do not print tilde-prefixed versions of directories relative to your home directory -p print the directory stack with one entry per line -v print the directory stack with one entry per line prefixed with its position in the stack Arguments: +N Displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N Displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Set and unset shell options. Change the setting of each shell option OPTNAME. Without any option arguments, list all shell options with an indication of whether or not each is set. Options: -o restrict OPTNAMEs to those defined for use with `set -o' -p print each shell option with an indication of its status -q suppress output -s enable (set) each OPTNAME -u disable (unset) each OPTNAME Exit Status: Returns success if OPTNAME is enabled; fails if an invalid option is given or OPTNAME is disabled.Formats and prints ARGUMENTS under control of the FORMAT. Options: -v var assign the output to shell variable VAR rather than display it on the standard output FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output; character escape sequences, which are converted and copied to the standard output; and format specifications, each of which causes printing of the next successive argument. In addition to the standard format specifications described in printf(1) and printf(3), printf interprets: %b expand backslash escape sequences in the corresponding argument %q quote the argument in a way that can be reused as shell input Exit Status: Returns success unless an invalid option is given or a write or assignment error occurs.Specify how arguments are to be completed by Readline. For each NAME, specify how arguments are to be completed. If no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. Options: -p print existing completion specifications in a reusable format -r remove a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications -D apply the completions and actions as the default for commands without any specific completion defined -E apply the completions and actions to "empty" commands -- completion attempted on a blank line When completion is attempted, the actions are applied in the order the uppercase-letter options are listed above. The -D option takes precedence over -E. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Display possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Modify or display completion options. Modify the completion options for each NAME, or, if no NAMEs are supplied, the completion currently begin executed. If no OPTIONs are givenm, print the completion options for each NAME or the current completion specification. Options: -o option Set completion option OPTION for each NAME -D Change options for the "default" command completion -E Change options for the "empty" command completion Using `+o' instead of `-o' turns off the specified option. Arguments: Each NAME refers to a command for which a completion specification must have previously been defined using the `complete' builtin. If no NAMEs are supplied, compopt must be called by a function currently generating completions, and the options for that currently-executing completion generator are modified. Exit Status: Returns success unless an invalid option is supplied or NAME does not have a completion specification defined.Read lines from the standard input into an indexed array variable. Read lines from the standard input into the indexed array variable ARRAY, or from file descriptor FD if the -u option is supplied. The variable MAPFILE is the default ARRAY. Options: -n count Copy at most COUNT lines. If COUNT is 0, all lines are copied. -O origin Begin assigning to ARRAY at index ORIGIN. The default index is 0. -s count Discard the first COUNT lines read. -t Remove a trailing newline from each line read. -u fd Read lines from file descriptor FD instead of the standard input. -C callback Evaluate CALLBACK each time QUANTUM lines are read. -c quantum Specify the number of lines read between each call to CALLBACK. Arguments: ARRAY Array variable name to use for file data. If -C is supplied without -c, the default quantum is 5000. When CALLBACK is evaluated, it is supplied the index of the next array element to be assigned as an additional argument. If not supplied with an explicit origin, mapfile will clear ARRAY before assigning to it. Exit Status: Returns success unless an invalid option is given or ARRAY is readonly or not an indexed array.Read lines from a file into an array variable. A synonym for `mapfile'.L<4,tpLD(H\  l\x !0183H57x8x8(:x;GG\HM,QWZ\|]^bcdghiljkl,n or},8Гalias `%s': invalid alias nameline editing not enabledbind_builtinlvpVPsSf:q:u:m:r:x:`%s': invalid keymap name%s: cannot read: %s`%s': unknown function name%s is not bound to any keys. %s can be invoked via , "%s"%s... `%s': cannot unbind ) )  ) )  ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) е ) ) ) ) ) ȵ  ) )     ) p h ) X only meaningful in a `for', `while', or `until' looploop countNULL%s %s %s LPOLDPWD=chdirHOME not setOLDPWD not setCDPATHpvVcommand_builtin%s: error retrieving current directory: %s: %s error setting terminal attributes: %serror getting terminal attributes: %s`%s': not a pid or valid job spec%s: invalid signal specification%s: usage: %s: ambiguous job specwrite error: %s%s: not a shell builtin%s: restricted%s: no job control%s: no such job%s: %s out of rangeSIGJUNKUnknown%2d) %sinvalid octal numberinvalid hex number%s: invalid option name%s: not found%s: numeric argument required`'+acfilprtuxAF%s %d %s cannot use `-f' to make functions%s: cannot destroy array variables in this way%s: cannot convert associative to indexed arraycan only be used in a function                                           x    h  X  H 0    neEadnpsf:enable %s enable -n %s _struct%s: not dynamically loaded%s: cannot delete: %scannot open shared object %s: %scannot find %s in shared object %s: %s u u  u  u u u u u u u  u  u u  %s: not a regular file%s: file is too large_evalfileparse_string topparse_stringparse_and_execute toppe_disposeparse_and_execute%s: ignoring function definition attemptsyntax errors in . or eval will cause future versions of the shell to abort as Posix requirescla:%s: cannot execute: %s~/.bash_logout/etc/bash.bash_logoutThere are stopped jobs. There are running jobs. not login shell: use `exit'logout exit :e:lnrsno command foundhistory specificationbash-fc%s: cannot open temp file: %s %c%s %s${FCEDIT:-${EDITOR:-vi}}${FCEDIT:-${EDITOR:-ed}}fc builtinx % % % % % % p % X % % % P @ currentjob %d started without job control%4d %s builtin hash -p %s %s hashing disableddlp:rt-thits command %s: hash table empty %s p ! ! ! ! ! ! ! h ! ! ! ` ! P ! @ %s: cannot open: %sdms' NAME %*s%s - SYNOPSIS %*s%s DESCRIPTION %*s%s SEE ALSO %*sbash(1) IMPLEMENTATION %s: %s These shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. Shell commands matching keywords `Shell commands matching keyword `no help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.acd:npsrw%s: history expansion failedhistory position%5d%c %s%s cannot use more than one of -anrwx1 1 p1 `1 1 1 1 1 1 1 1 1 1 X1 1 P1 1 H1 @1 1 1 1 81 ahrlpnxrsjobs_builtinno other options allowed with `-x'8: 9 0: 9 (: 9 : : 9 9 9 9 9 Unknown error(%ld) - %s%s: arguments must be process or job IDs%s: invalid file descriptor specification%d: invalid file descriptor: %sinternal error: getting variable name%s: invalid line count%s: invalid array origin%s: invalid callback quantumu:n:O:tC:c:s:empty array variable nameMAPFILE%s: not an indexed arrayC YB YB YB YB YB YB YB YB YB YB YB C YB YB YB YB YB YB YB YB YB YB YB YB YB YB YB YB YB YB YB C YB YB YB YB YB YB YB YB YB YB XC YB YB YB YB  C C xB dirstackdirectory stack emptydirectory stack index %2d %sno other directory%s: invalid timeout specificationersa:d:i:n:p:t:u:N:read_builtinread error: %d: %sZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z x[ Z Z `[ P[ Z Z Z 8[ Z Z Z Z Z Z \ Z \ \ H\ [ can only `return' from a function or sourced scriptfv%s: cannot unset%s: cannot unset: readonly %s%s: not an array variableSHELLOPTSoff%-15s %s set %co %s allexportbraceexpanderrexiterrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedxtracecannot simultaneously unset a function and a variableXabB=ir p nevEThHTT@r 7q kmC˱nұfٱ|$߱butPxiTPq pǼvr p xdeclare -%s %s -%s aAfnp%s: not a function-ra-rA0                                               Ѕ shift countfilename argument required%s: file not foundcannot suspendcannot suspend a login shellunknowntrap -- %s %d trap -- %s %s ~ ~ !  ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~  ~ ~ ~ ~    %s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -type-path-allafptP ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ  ʝ ʝ ʝ ʝ  ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ ʝ  ʝ ʝ ʝ  (%s, -%c) (-%c) %-20s %16sunlimited%s: cannot get limit: %s`%c': bad commandhardsoft%s: cannot modify limit: %score file sizeblocksdata seg sizekbytesscheduling prioritypending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timesecondsmax user processesvirtual memoryfile locksc#d*8e ?f#i Slc8mu8npq rs̸8t׸uv 8x  agourwxu=%s,g=%s,o=%s Sp -Sumask%s %04lo `%c': invalid symbolic mode operator`%c': invalid symbolic mode characterOPTARGBASHOPTS%s: invalid shell option name-u-sshopt %s %s psuoqautocdcdable_varscdspellcheckhashcheckjobscheckwinsizecmdhistcompat31compat32compat40dirspelldotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoreglobstargnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinteractive_commentslithistmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echocannot set and unset shell options simultaneouslyؼ м ȼ     9,@$LhT$^(huX}   4#$Dʻһlۻt4x$$t$'p 4$> S$+i [d$|hh $ϼڼmissing hex digit for \xwarning: %s: %s#'-+ 0v:hjlLtzlld O O O O  O O O O O O O O ( ( ( ( ( ( ( ( O O O O O O O  O O O O O  O O O O O O O O O O O O O O O O O O O O O O  O O O O    O   O O O O O O O  O O O  O  O ( O x                                  &            /           `%s': missing format character%s: illegal option -- %c %s: option requires an argument -- %c -r%s: invalid action name-D-Ecomplete bashdefault-o %s dirnamesfilenamesnospaceplusdirs-a-b-d-f-g-j-k-varrayvar-A %s helptopicrunningsetoptsignalstopped-G%s %s -W-P-X-C-F-E -D compopt +o %s +o:DEgroupserviceuserabcdefgjko:prsuvA:G:W:P:S:X:F:C:DEwarning: -F option may not work as you expectwarning: -C option may not work as you expect%s: no completion specificationnot currently executing completion function                  p    ` P         @ 0             h P  8 (    6 :IR\d@#a bch d@ɟ[eVf g@jks7 @u2v                                                              M M M M M M M M d  M M M M M M M M M M M M M M M M M M M d  M M M M M M M M M M M M M M M M M M M M M M M M M M   ` ?*+@!asciialnumalphablankcntrlgraphlowerpunctupperxdigitNULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzerotwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDEL K# 2# # # " " " " " w" a" M" ." "  ( & & & & & & & & I' I' & & & & & & & & & & & & & & & & & & & & & 9 `8 `8 `8 `8 `8 `8 `8 `8 )9 )9 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 `8 w8 w8 m &,28>D:J)P?*+@!asciiwordalnumNULSOHSTXETXEOTENQACKalertBSbackspaceHTLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELBASH_REMATCH/dev/stderr%s: bad network path specificationsocketconnect%ldm%d.%03dssh_makepathmsh_realpathTMPDIR/var/tmp/usr/tmpshtmp%s/%s-%luw+(x (x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x (x (x (x  x (x  x (x (x (x (x (x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x (x (x  x (x (x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x (x (x (x (x  x (x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x  x (x (x (x w 0y 0y y y y y y y y y y y y y y y y y y y y y y 0y 0y 0y y 0y y 0y 0y 0y 0y 0y y 0y y y y y y y y y y y y y y y 0y 0y y 0y 0y y y y y y y y y y y y y y y y y y y y y y y y y y y y 0y 0y 0y 0y y 0y y y y y y y y y y y y y y y y y y y y y y y y y y y 0y 0y 0y | } | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | x| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | x| } } } } } } } } } } } } } }  } } } } } } } } } } } } } } } } } } } } { } } } } } } } } } } } } } } } } } } } } } } } } } } } l ]  } {  } } } } } } } ~ } } } ~ } ~ } ~ }  ~ %s/cur%s/tmp%s/new%s/%s%s/invalid base0123456789ABCDEF0123456789abcdef'd OAOBOCODOHOF5.1_*\AaIiCcDdPpYyRrSsXx~ hl^$0ftFT;,%wbeWBE|` l|h^0%bBFT` l|hwW^0bBFT` l|h^0bBFT`abortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-search-historyhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-regionmenu-complete-backwardnext-historyold-menu-completeoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linereverse-search-historyrevert-lineself-insertskip-csi-sequencestart-kbd-macrotab-inserttranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-ruboutvi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-tonon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-again6@ < H Y g ( u` } Y     P #  @ p 0 1 D0 X p 0= 0 V    P  p = J W e F` n@  p# p ~     P  p (0    # 5F TR f z@e P @ m   0    й  pp . @ QP] b p }`  з   `    p   ` $ . ;0 D T ` m v 0 p  @  0       0 ,p 3 ;P Fо Pp Z j vp    warning: turning off output flushing--More--// "\'`@$><=;|&{(Display all %d possibilities? (y or n)bad value %d for what_to_do in rl_completenoneaudiblevisible"%s%s": "%s" %s%s outputs %s \e\C-%c\C-?blink-matching-parenprefer-visible-bellterm=mode=%s: line %d: %s $endif without matching $if# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on C-\M-unknown parser directiveno closing `"' in key bindingControl-Metaprefix-metaINPUTRC~/.inputrc/etc/inputrcbell-stylecompletion-query-itemshistory-sizeisearch-terminatorskeymapset %s %s %s is set to `%s' C-CTRL-otherbind-tty-special-charsbyte-orientedconvert-metadisable-completionecho-control-charactersenable-keypadenable-meta-keyexpand-tildehistory-preserve-pointhorizontal-scroll-modemark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsrevert-all-at-newlineshow-all-if-ambiguousshow-all-if-unmodifiedskip-completed-textvisible-statsemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insertendifincludeEscapeLFDNewlineRETReturnRuboutSPCSpaceTab$else found without matching $ifcompletion-prefix-display-lengthprint-completions-horizontally@ @ @ @ @ @ @ @ > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > @ > > > > @ @ > @ @ @ > > > > > > > u@ > > > f@ > W@ > H@ > ? `)p&\d& d#&1pA Nxe  |    >@(|&   " 9 M Op) p' ( Z0( G( q' ~pB * =i[ju8 : o: Q         ] [ [ \ Z ] \%o_rl_col_width: called with MB_CUR_MAX == 1debug: insert_some_chars: count (%d) != col (%d)/var/tmp/rltrace.%ldreadline: /-_=~.#$readline_callback_read_char() called with no handler!coliamxnkm@7DCclcrdceiimkDkHkIkdkhklkrkummmopcvbvsD&.&C&&&&&&&H@L(8<0,4$& &&&PT(arg: %d) X%lu() <>;&|$"'`unknown expansion error:$*%^ = ;&()|<>event not foundbad word specifiersubstitution failedunrecognized history modifierno previous substitutionP311111111111111111111111111111111111111111111111111111111111111831151111111453P321112-K ~ ~;:^ ;L;p;;P;;P<p8<0T<t<p<`<<@=t=@== >` ,>0X>>`>p>>?EPRE\8F^hFЅFpF,GLGpGжG0G H`HиH HpHйI0PIIPII$JTJпJJKLK`xKKK KpL8L@pLLLL $MHMlM`MPMNDN0tNNN OP4OXO|O@OOO@ P,PTP |PpPPPp QLQ xQQ QR@Rp`RRPRRLSSSST`HThTT0T@TU8U0`U`UUUUPV8V\VVV0VP,W\WW@WW@X@XlXX@XXY4YpdYYYYZ@8ZdZZPZZP[8[@`[ [ [ [p \P H\p h\ \ \ \ \` ] P] t]]@]]^,^PT^|^P^^@^p _@__@___` <````$aDataaa`+bp;TbPbQb Zbp[ c`\Lcpccccecj dl@dstdudzez0ezPezpe{e {e@{ep{e{f{@f{`f|fP|f`|f|f|(g|Hg0}lgp}g}g}g}h~@h~hh0hhh ip$i Tiiii0iPjp4j\j j`j`jk00k`Pkxkkkkl04lP\lpl@llm`@mpmmm mnЌ8nЎnnno4opoБo0oo p@pp ppPqPq qPqqq$rОTrxr`rr s`8>`?P???@@(@T`ABPCCD@pDhEPEEFF4 GXG H`HH$IPpJJM Q0Q`R R@RpRR$RD@UtUPWW 0X8XtYZ@[\P@]|@^^a@eTetf`ffPg iP@k`kkmn< n\@n|oo pp<q\@s0v` 4T x@(XЏ(H x@`Б Lptp0P `Л 08l8hP`(Xx4\ P(йT,`PPPP@ ,L|P@`0`(L|0 ,TPt` 40X|@TtPP ,LlP $\0P`T tPp H h ` ,@T `0#`%%@`&l&&0++8Lp>|@C0DPHHI0O P Q8`RR0XX8Z [@_`_0_P_p@````pw8wd@xpxx`yy(Pz\`}@ ЀH 0t   p 0$  t    8 h  @ В 0 0T Pt `    0H 0 @ Ц< lЯpD0л8l0 PP@, hP\@px0p0@`@`@pl H| 40p@TP@ ,`-T0>p> @?DB@EGPGGHH|III0J(`JHJhJ`KKL`LpL8MhPMM NPN N8 NX Nx N O 0O O!PP4!pPT!@Qx!`Q!0R!PR! S"pS4"@TX"T"T"T"V#pW4#PY#Y#[#0\$p\($P^X$_$p_$@a$a$Pd(%hX%j% k%pl&lD&@nt&n&n&@o&po 'oL'q|' r'`r'r(s,(Pt\(@u(u(v)v8)0w\)`w)0x)Px)y*yD*zd*0z*z*{*~+~<+Pd++`++p,@,h,Ђ,0,-pT---Д.P4.d....@/`/P/0//0$0УT0P000P01P$1`L1p11102`82t2223@03PX33P333з404`4P4P4p45$5`T5|555@5p 606 P6606p67@87d77078 8D8d888 9H9x9@9@9:P\:::;D;;;;<@,<T< <p<0<=00=T===P=$> L>0l>>>?0? \??0??@ @p@@d@P@@P@`ATAAPAAB@B0|BB`B(CHChCpCCCpD8D hDPD`DDDP,E\EEEEFp,FTFFPFG0DG`tGGG H@H0pHHHI0HIII"(J#HJp&J*J*K* K`+`K+K,K0,K`,K, L-LL.lL .L0.L`.L.L/$MP/LM/tM0M0M`1M10N1PN3N5N7N7O7AB z ,0wGAB HU A G ]A  Pw+AB g 4@`wAB MH^ AA \ AC xw>AB HqA w)AB e ,w^AB Ho A E \A <$x AB Ja AAA G m AAA H ,xZAB HMA  P0y[AB e H 0tly}AB IS AA G RAA (yAB I AA G 4|zAB Ie AA E Q AA E < zAB J AAA A G AAA A ,Ld{rAB JJ[ AE ,||AB EZ AAA A 4D}AB WG AF { A(}|AB WS AB (~%AB I{ AA G <_AB LNA  `PAAB HtA |<AB x  WAB LFA $TAB QC{ A :AB HmA ,1AB m $4LCAB Tf A$\tCAB Tf A(OAB TIi A(kAB TLB A+AB g ([AB WLo A((H[AB WLo A(T|IAB TIc A8AB JLj AL X AA $IAB j C X 8<AB JKu AB h AG $ KAB l A Z HȂSAB O (hjAB QIG A0LmAB JCg AH k A(AB QR A\~AB W AB T AC T AC T AC T A<T<AB b AAA F { AAA J ,AB E AAA E ܈&AB HYA $6AB K B e <KAB Cu) AAA E x AAA A PAB Z p-AV U , tAB ] H ` H c 0pAB EH AAA A (LIAB DC{AAA  p1AB m $@SAB C A H hȎ0AB H_A  Ԏ5AB HdA !AB ]  3AB H]A  3AB H]A $8dAB Cx A A @@AB CxA 8dAB CCP AA E [ AA C (@AB CK AA G (4'AB IFN AG 88AB E AAA E {AAA ,4GAG Hc A L EA ,d<AB Ex AAA E  AB CA 4AB p <AB ^ AAA G H AAA E ,(AB `j AAA H (HAB XAAA ,tlAB d AAA K ,kAB g ,|AB O AAA K AB MrA  hAB MrA ,<ԧ\AB hD AH lRAB A D $@AB P E A D8AB JKs AD m AJ j AAB Z  ,AB h (@QAB J@AAA l46AB r $TaAB S B D ,vAB HU A G HA (yAB JhAAA , @WAB Hy A K EA $@ pAB IrAA 8h ث]AB JNK AI  A, ?AB He A G EA  !AB HPA $ `AI | B T , !PAB ` AAA G P!AD R p!?AB { ! AB P ! AB P $! *AB L A Y ,!(6AB HQ A C TA ,("86AB HQ A C TA  X"HLAB HA |"tAB Q  "t)AB CaA $"NAB IAA $"GAB c_ A #а(AB HWA $4#ܰ<AB o F C $\#ZAB O F A  #,AB R|A 0#xAB I[ AA G EAA  #kAB H^A $$@&AB N G M ($HAB Q <H$HgAB J# AAA E U AAA H $$x<AB Mf A,$]AB RZ A H _A $AB X  %)AB HXA $%̳$AB ` @D%ܳAB CCY AA D b AA L M AA A 4%hAB TS A E ] A B ~A ,%AB DC AAA E 8%#AB R AG A A,&$AB ` ,L&AB Ey AAA D 4|&$AB INv AG h AA 0&̼cAB QC^ AB i A,&n AB M AAA D @'H AB CCC AAA A  AAA E <\'|AB M AAA G  AAA D ('TAB W AA E ,'UAB Hk AAA A ,'(BAB CD AAA H (((HAB DV AA A @T( AB CCC AAA G ( AAA E $(sAB M`AA (0AB E0(AB DC AAA G 0)AB CD AAA A 0H)XVAB EFr AAA E H|)AB CCGB AAA C O AAA F zAAA L)(AB E AAA D  AAA D F AAA G *AB D 8*AB D X*AB D x*xAB D *hAB D *hAB D *h#AB _ $*x0AB V G O $ +)AD R A P H+AB D h+AG G $+xFAB WGc A+ AB E ,+7AB OU A H EA ,,?AB SU A L EA 0, AB E  P,8AB [ B t,8AB [ B $,AB N G A $,&AB S J A , AB E <-AB RK AAA E E AAA H $H-8?AB X E ^ $p-PjAB X E E (-{AB RJk AE -AB X  -AAB HpA  .KAB RtA ,,.DAB K} A D i A F ,\.mAB Kb A G W A H $.JAB Sr A.,(AB d $.<AB R C C .4AB N /4AB N $AB SV AC { AD ,8/[AB S AE 0D82AB Ha A K D A K 0x82AB H\ A H R A E ,82AB MIU AI $83.AB Z K A ,93AB U AAA E $49L4UAB HZ A B ,\94AB JIu AD $95dAB ]} A A $9\5AB V~ A A 495gAB TY AG b AE ,: 6)AB JLv AH $D: 7"AB W F A $l:7DAB H^ A F $:<7GAB d A ^ :d7-AB i  :t7KAB _ F $;7_AB ~ G V ,(;7AB W AAA H 4X;8AB JF\ AH U AB $; 95AB X E P ;89 AB E $;(9JAB JCx A <P9>AB SfA  $<l9AB EA $H<9OAB JC} Ap<:IAB E $<@:`AB IQAA 0<x:AB HD A H E A J @<;AB H] A G U A B { A D UA $0=;:AB Hb A B $X=;AB Ph A A (=0 ?HAB D ( >P?cAB QCJ A L>?*AB KVA  p>?:AB KfA ,>?{AB MKO AE > @-AB i (>@PAB QFt A(?@@pAB Q@ AA B $AB JGh A,`d]AB cZ AAA E ,`AB EL AAA A ,a6AB Mq AAA D LaAB X ,laAB Ji AAA G a:AD t 0aqAB CCIU AAA A ,aPAB E AAA B , b@AB EB AAA C PbAG K LpbAB DM AAA C  AAA D G AAA F bp AD Z bp AG H cp #AG Z , c AB E AAA G 0Pc`wAB Sv AC \ Fc+AB c c0AG g 0cAB DKF AAA E ,cAB E$ AAA A ,(dHAB E AAA F 0Xd4AB CCC AAA F ,d$!AB rL AAA D ,d$AB J AAA D ,d!AAB M AAA C 0e&AB DU; AAA F ,Pe *AB Jn AAA B 0e,AB IQ AAA H <e,EAB R AAA G  AAA A e|MAG H f|MAG H 4f|MAG H 4Tf|MAB JGL AG  AF ,fDNwAB Cl A E _ A H 8fNAB SS AF p AG ,fOAB HM A G A ,(gOOAB LG A A uA ,XgOyAB CO A B _A ,gPUAB OG A F oA ,gHPOAB LG A A uA ,ghPsAB LI A G QA ,hPOAB LG A A uA 0HhPTAD We AF J A$|hQTAB A L C  hAB X E ] < tAB PV AAA D  AAA C 4`t@AB JM_ AF p AA DtبAB w F C E S E K E K E K ,t MAB Zk AG $u@/AH \ C F $8uH1AI W G H ,`u`?AI R D L D N upAB T (upOAB bI AA 0uAB N^ A H R A E ,vPsAB NJ A D m A B $@vCAB JGm A,hvȫ/AB LR A F EA ,vȫRAB h E D L Q ,vwAB P AAA H vHLAB HA $wt,AB _ F C <Dw|AB J AAA C  AAA D (wܮCAB I AA C (wwAB e H h H 4wT4AB Pq AA A  AA B x\AAB NnA  8xBAB OnA  \x7AB KgA xбAB X  xбCAB OoA  xCAB KsA  x(NAB OzA  yTAK D  ,yT7AB KgA Pyp.AB j (py_AB SG Ay$AB ` $yIJ*AB Y L A y̲9AB u 0zpAB LK AA L EAA 08z(AB Lf AA I eAA lzAB S ,z;AB P E V B J z AG A ,zAB J AAA H < {tAB J AAA H  AAA B 4L{aAB Ke A D O A H OA <{<AB JH AAA H J AAA C ,{#AB J AAA A ,{\AB CI{ AAA C <$|AB ML AAA A  AAA E 4d||AD cX AA F T AA B |AL A (|}AG McC A|8AB Z }8"AB ^ $(}HAB P A C $P}@AB J K i x}AB }nAB j $}<AB C? A B $}ԽLAB h E W (~AB OL AA H <0~dAB TH AAA F  AAA A p~AB  L <~LAB f G P H r F j F Z $~-AB K B \ ~1AB *AB 4-AB CP0AB [ B Y G Y G m C y G k E { E R F I G a G a G p H k E k E k E X H k E f B d D | D f 4 AB XO AE b AE ,HAB To A I BA DxH*AB a AD ] AB @ A,0AB So AB XIAB MNc AF | AC d AK H AG ,LAB PM_ AH H|TPAB MILa AA D AC i DC XȁXAB M AAA A  AAA A b AAA E c AAA E $$aAB Ei A F $LD[AB Ei A F t|AB R B xAB b C TcAB _ $܂AB EA  .AB H]A ,(AB VO AG ,X8?AB SU A L EA HEAB A $xqAB NJ A D $Ѓ4AB l A C ,AB J AAA  (DAB KtA $L,AB ` E C $t +AB O F R 8fAB Xv AF  AH (؄HIAB JxAAA ,lAB XO AE ,4,AB UR AE $dqAB O\AA 8DAB JK AA U AB ȅ#AB _  (_AB LNA , dAB CFrAAA ,<AB DLrAAA 8l$~AB Y AAA G zAAA ,h7AB H[ A I EA 0؆x|AB IP AA B YAA , BAB JN AAA B <$AB ` X\AB J AAA B ` AAA E Y AAA D  AAA A (LAB J{AAA  )AD HZA 8yAB JJM AC V AA ,D,7AB H_ A E EA ,t<AB ]Y AAA D 4AB TO AA  A8܈dAB NG AAA E kAAA 8AB JJM AC Q A4T `AB JGJ AA S AD 84yAB JJM AC V AA 8ȉxyAB JJM AC V AA 8yAB JJM AC V AA ,@AB UR AE ,ppAB UR AE ,AB ^\ AB HЊ AB RI AH h AG V AA 0tfAB ^q AE L A(PAB ^V AH (|tAB Ix AA A 8AB IY AB } AB LAB Q LAG Q ($LAB Io AA C 8PAB JFMw AH x A84AB JFMw AH x AHȌAB ZI AF C AD W AH ,AB CCOAAA ,DlAB En AAA G ,t, AD OB AAA G /AB H^A @ȍ{AB Va AE T CI Y A( TAB JI A(8AB JI ALdlAB JIp AA C AL P AG K AL D AB VTq AA ` AG q AF 8+AB M AAA G oAAA ,8AB g AAA D (hXZAB U@ A0ZAB JKo AH H ADȏAB JK AAA E Z AAA A IAAA 8AB CMG AAA C AAA LtAG H ltAD H 8t1AB f AAA E TAAA ,ȐxAB JS AAA A ,H2AB S] AD D(XvAB JK AAA E E AAA A IAAA DpAB JK AAA E Z AAA A IAAA DAB JK AAA E Z AAA A IAAA D AB JK AAA E Z AAA A IAAA $Hh4AB j C C $prAB SYAA ,WAB Zi A I EA ȒAB X ,7AB H\ A H EA <AB OL AAA G 2 AAA A <XAB OO AAA D B AAA A < aAB CQ AAA A V AAA A ,ؓ8 ,AB w~ AAA E ,8 AB Ek AAA H (8AB wRU A<dlAB ZY AAA E  AAA A ,LAB Jh AAA H ,Ԕ7AB OU A H EA 1AN a $AV A $D@AB p E G  l"AB EXA  AB T  AB L $Е -AB Y D L ,(AB MK AI <((AB P AAA D G AAA F 0hx AB i L V B K A  ,AB h 4!AB Qi AA A O AA G 0"AB OG A F y A F ((x#AB UL AC 4TL$AB EX A G O A H IA $AB T ,$AB TU A C hA ܗ%?AB { ,4%AB JKg AH ,%3AB o L%AL A $l%@AB ^ G W %AD A <%AB JW AAA A t AAA A $&=AB _ F T  &VAB OBA 0@&8AB GC; AAA E t(AG O $(aAD _zAA 4)AG O $ܙ4)@AB Xc A,L),AB DC AAA F H4L*GAB R AAA H J AAA C e AAA H 8P+vAB JR AAA F JAAA  +AB CA ,0,}AB R AAA C .=AB y 0.AB Y 0P.AB K A F L A C 0L/]AB DC5 AAA F x0]AB OIA $ܛ0PAB Oo A F 80>AB J AAA L rAAA <@1{AB JNp AD  AH , 3AB Oe AAA F |4I AB [  AAA G  AAA F  AAA G  AAA G h AAA E  AAA B ,0`?oAB JQ AH (`AAB I AA D ,dDAB a AAA A GHAB j C <GAB OY AAA B S AAA B  @JAB Y 4@@JAB I] AA E   AA E xK6AB r K-AB i <KAB M\ AAA A q AAA D <NAB J AAA A C AAA H 08RAB OE A H 1 A F ,lZgAB M AAA H 4\AB OKi AI t A ԟL]^AB ETA ,]AB U AAA F $(^7AB ^ G J P_AG R 0p_\AB MJl AI J A,,_AB A{ AH <Ԡ_;AB J AAA G l AAA A (anAB Z| AF $@ bOAB Ws A$hHbOAB Ws A$pbOAB Ws A$bOAB Ws A$bOAB Ws A$bOAB Ws A(0cAB gRI A(\tcAB Vk ADcAB MO AK i AF M A$Т eWAB QA A$XeWAB QA A$ eWAB QA A$HeWAB QA A(pfAB Tv AdfHAB D $foAB SE A D f@AB | 4fAB bn AD n A <TgAB PsA D`gAB OC AB c AD U A0h\AB Or AC R A$ܤDh4AB ] H K $\h4AB Z K K (,thjAB ZA AA XXh^AB L AAA C _ AAA F Q AAA D O AAA F iKAG d D ,إiEAB j8 AAA H ,lAB j AAA C ,8oeAB OA A D JA ,h(phAB OC A B JA hp AF X hpAD U  ئhp'AB D^A ,tpTAB LY A G T A C ,pAB Q ,LpFAB O AAA C ,|rdAB Mh A G ^A 8sAB DCe AAA A dAAA (htKAB MNk A(tAB JxAAA 8@tAB J] AAA C ^AAA ,|TuAB Jy AAA G $v>AB z <̨Dv/AB JJp AH  AA H 4wpAB J AAA D ` AAA E AAA (XXxAB LN AA A xAB  H 0yAB OE A H G A H 0ܩy#AB L  A G Q A F H{9AB JFW AE S AD  AH \AAB }  |rAB TYA $pHAB Z K _ $ȪyAB GlAA 4nAB Oz AC O AH ,((AB U AA ,X3AB Mn AAA G AB X AB S @ȫAB CC[A AAA H q AAA A 4 jAB CCL AA A KAA DAG H dAG H 8[AB _h AE m AB  AB \ ,\AD JE AAA A 0AB Ld AA C [AA D|DAB @ <d0AB E& AAA G l AAA A <AB JI AI  AD ,L%AB CDz AAA A $L}AB InAA < AB G  \"AB HUA AB [ ,3AB W F D D J ,ЮAB QS AAA A ,AB Oa AAA A ,0PAB Oa AAA A ,`AB Oc AAA A <AB J AAA H O AAA A ЯAG O AG O AG O 0AG R ,PAB FP AAA A AG H AD H AG H $EAB Tl AHȥCAB U AAA E L AAA I A AAA A $ȚBAB Ti A$|BAB Ti A$MAB Tt A(̱DQAB P| A<x)AB G AAA G Q AAA A 8hbAB ^ ,XAB E AAA F ,2AB DC AAA C (AB JHG AK ,AB J` AAA H (\AB JFh AD 0@AB DC2 AAA A 0t|AB CI' AAA G \ AB S} AAA B  AAA A  AAA A [ AAA A 4AB R[ AG  A,@P[AB EC AAA B pAL F $6AB \ I M $8AB P E _ ZAB V ,cAB JRAAA ,00AB H| A H EA ` AB E  dAG OKA $AB ` ĵ"AB ^ $+AB N G R , AB JKF AA $<AB L I A (dAB IOo A0AB Ue AB F A0Ķ\vAB UZ AE | A4AB CHs AA E T AA A (0 zAB Of AH\tAB R@ AAA H  AAA A AAA ,AB R AAA F $طKAB X E j 0AB HR A B D A C 04AB HR A B D A C 0htAB P AE Z A,dAB T AG ̸D5AB CmA ,`AB ]ENO A4 mAB CM| AA G  AA J ,XAB V AA LAB CD AAA B y AAA D V AAA G 8عhUAB WA AD l AC AD A 4| AG A ,TlAB CCHx AAA D $VAB Hp A L 4 AG A ̺$AL A ,AAI V H H H H (4JAF Ek AA G HX/AB k ,hh7AB OU A H EA ,xAB My AAA D $Ȼ3AB c B J ,AB h  ,AB h  00GAB OsA ,T\ AB MKf AF HLAB H AAA B A AAA D L AAA A м 3AB o  @AB K}A 4AB p $4AB Ed A C \dAB  |NAB J LAB M AAA G b AAA C y AAA A $AB LJ A F $LsAB HB A B <MAB ECA  `VAB MDA  4AB p ,,jAB Hq A C dA ,ԾljAB Hq A C dA 4AB p 4$AB JHz AH n AI \t4AB p |4AB p 4AB p ,AB J AAA C $AB Hz A B <4AB p 4\4AB p T|4AB p t4AB p 4AB p 4AB p  EAB L A 0(AB HD A H z A E 4,AB Nq AA D r AA A <dAB U AB k AD l AC ,MkAB Cu A D iA \N]AB J' AAA A  AAA E \ AAA A  AAA A $SYAB IJAA H@PSAAB J AAA G  AAA D \ AAA A TU1AB FfA \pUAB J AAA H z AAA C   AAA A  AAA A $0Y AI C C O 8(Y2AB n XHY;AB w  xhYZAB CRA 0Y^AB Og AF \ AYAB Y YAB 0 YAB FFR AAA H (@0pzAB [ B E A ,lpFAB ^ G M C M p#AV K $pdAD  D [ $ptAD A B k  TqOAB e H 00qAB g F \ D o A ,dqAB EA AAA D ,tAB c} AAA B H|vAB QB AAA G b AAA C S AAA A <vAB Qh AAA A R AAA A (PwSAB EQvAAA ,|wAB LE A K ZA $xMAB CF~AA $,xaAB t A h ,txAB M} AAA H L,yAB JE AAA C  AAA G L AAA A 8|{AB UK AL  AC ,(}AB Jo AAA A $gAB U H F ,AB J AAA A ,@AB CIM AAA A pp$AB ` $AB ` HAB M AAA A J AAA C \AAA 8ԆAB X AE w AH 8BAB k J \ԉAB Z @|ԉ AB Dz AA E a AA A n AA A 4AB Qt AG Y AF $AB OAA , AB [} AD <PAB CCHu AAA G  AAA E <AB Jj AAA F  AAA F 8pAD J AAA D AAA 4 ĘAE X_ AB d AC ,D<AB LXH AA ,tAB Q AAA F <, AB FL AAA F  AAA F $AD V A A < AB CCHs AAA A Y AAA L LL$.AB PX AAA B  AAA E 1 AAA D AL I 0gAB Oz AC U A,@AB UJA AD  AQ  0@AB @ E M C M C t,AN H $,;AB V G Z DAB L 4AB K (4]AB SCAAA ,(h^AB EQAAAA ,XAB `T AAA A ,AB LE A K ZA  X9AB CqA ,txAB CCChAAA $ ĮmAB u H l 84 AB DCd AAA G dAAA <pAB N AG N EM U A$LAB Pw A,(}AB FCLaAAA XxAB Ez AAA C  AAA E  AAA E T AAA K 8d_AB O] AH  AD ,AB Uw AH $SAB S{ A$AB EAA $ AB n A A 4H8AF Li CA H P CA D $[AB e H j 0(^AB Og AF \ A$TjAB Cs A F 0AB DC AAA A L88gAB WN AAA E c AAA B  AAA C X%AI Z ,hAB _ AAA E -AV U LAB V AAA A d AAA A  AAA G <HxAB DCN AAA E  AAA A <AB R AAA A I AAA D 089AB CD# AAA H DAB N (DAB CC|AA (HqAB CCeAA LtAB R AAA E V AAA G U AAA H ,LAB XH( AD ,AB Ua AAA D ($pAD \ G Z F 0PAB Hm A G x A G ,lAB E{ AAA A $EAB e H T ,9AB Es AAA B ,  AB u AAA B L<dKAB N AAA H  AAA A  AAA A $d3AB W F N $|3AB W F N <AB Qk AAA F G AAA F <$AB Pk AAA G G AAA F ,\ AB [ AAA A $tKAB My A,AE Y AAA A <\ AB Xj AAA H  AAA E 4$iAB JKU AB s AL\5AB DJx AAA D  AAA A  AAA A ,Z AB jx AAA H 4$"kAB JKU AB u A4\"AB P AE f A<L"1AB DJy AAA C  AAA A ,%AB J AAA A ,(AB P AAA A ,*OAB Hh A D UA 04*AB Hr A B C A D 0P*AB Io AA C UAA 8 +AB JKM AB W AH + AB E $++AB N G R $+>AB N G e 0,,AB h P,9AB u p0,9AB u $P,}AB |w A A $,}AB |w A A -AV A -VAD P  @- AB E ,@0-AB So A B A (p-MAB DYiAAA (->AB JmAAA ,-AB So A B A $(.,AG [ E C  0.7AB s @P.AB J `@.AB U @.AB J  0.+AB H^A <.#AB _ 0L.GAB JIW AJ M A h.AB  A </AB L  \/AB  A /AB W  /AB  A l0AB L  l0AB  A 01GAB JIW AJ M A <41AB  A $`1LAB O F s 2 AB E $1LAB N G s 8 2AB MH AAA E 2AAA , 3AB _{ AB H<44AB V\ AB  AE  AB 5uAB G F ,$6 AB J AAA G ,8JAB GW A F `A  $85AB GiA ,0@8AB MAAA (`9AB T At:iAB e ,:AB O AAA B dAB i D M 8XSAB Jw AAA A GAAA ,4|AB G AAA G dlCAB   YAB KIA , AD DC AAA H ,2AG J AAA A <AB J AAA C  AAA A (HhwAB IR AA H t*AB f *AB f 4zAD JK} AH T A$$AB `  4.AB j ,D,AB h LT,AB h ,ldAB J AAA F <AB CD" AAA A o AAA A ($qAD VT A(x[AB h M C E $4<AB j C K  \7AB KgA @0AB Dt AA C h AA F / AA G ,4AB QAAA CAB  H AB QH AAA A G AAA F GAAA ,` AB Q AB ,P AB J AAA A FAB HuA (AB CC AA A 0sAB QCn AB i A,D?AB Hb A B IA  t,AB LA <AB cF AAA I G AAA F hAB K hAB K h[FB R 89AB u X*AB \ xBV L  hLAM c G $6AB f G A 0rAB P_ AA D wAA xAB t ,8XAB Jq AAA G $hRAB N G y ,0AB Mk AD ,AB Jl AAA A `AB  4AB p 400yAB Ok A B a A F OA (hxAB IK AA G (lAB CT AA E ,AB En AAA G ,!AB P AAA D  !$AF \ 4@!AB T AA H uAA <x(#|AB Q AAA E G AAA F h$AB  B 8%AAB Vl AB L AC $ (AB Nz A D (@ (qAB N AA C ,l 4*AB ^& AAA F , =AB [U AAA B $ UAB R{ A G $ LV@AB N G g $!dV@AB O F g $D!|VlAB O F S $l!VlAB N G S ! W,AB d 0!WSAB Rf A D @ A G !HX%AB Z ,"XXAB OL AB 48"XkAB Rm AE a A(p"Y~AB  F a G "d[!AB Y "t[4AB p ("[AB D AA H $#H\8AB ` E K 0#`\AB R P#`\AD A p#P\AB P #P\ AB G #@\ AB \ $#@\AB \p A A $#\lAB OL A A $]yAB `TA  D$\]1AB HdA $h$x]AB L I A $p]AB W $p]AB Y $p]AB Y  $p]/AB EeA  %|]/AB EeA 8%]AB U 8X%]uAB MO AAA F IAAA  %]~AB `YA <%(^KAB Mq AAA D ~ AAA G (%8_XAB MJ| A $&l_RAB N{A H&_AB L h&_\AB &_ AB E ,&_ZAB Hd A H `A ,&_OAB Ef A A ]A '`AD A ,$' `AB CD AAA G $T'`AB RK A G |'aAD K $'aCAB s A K 4'aAB Y AB e A,'tbAB MJp AE (,(dxAB OLz AG ,X(hdAB QV AE $(d+AB L Q F $(d+AB L Q F (dAD E ((dXAB MJ| A,$) eQAB s B M C H 8T)AB z ,)fhAB OA A D JA ,$*ghAB OC A B JA $T*\gJAG Pp A,|*grAB OG A F LA @*gAB O A F Q A F L A C LA $*0h?AG j F F <+HhAB CCCN AAA C dAAA  X+i>AB HqA  |+iOAB D A $+ jrAB L`AA +xj:AB v +j6AB r ,j6AB r 8(,jAB MJ_ AF O A(d, AB I $(>+AI S C J P>2AB n ,p>GAB Hi A K EA >0&AB b >@)AB e  >PYAB HLA $?YAB L A H ,,?Ĝ'AB MAAA 0\?ĝAB SJ AG Y A$? eAB FYAA D?hHAB I AA G E AA A J AA L L@p@AB HR A B  A A t A C L A C r A E P@`$AB HSA t@lAB V @l=AB y $@VAD Q B } @Ġ8AB t ,@AB He A G &A ,,AdeAB Em A B kA ,\ATAB v G F B K AԢ"AB ^ $A&AB \ A A ,AfAB H[ A I tA B,;AB w $BLAG F DB< AG A $dB,,AB d A C B4 AG A $B$'AM E E N B,"AL T B<&AP T $CL/AB N G V ,Uo<<-{}Io;(O);|& ͖@|p~PvAۖMuX~@~ޔ~-}`````&`1`9pvϕpv>pv0vh@}GOX`c`q0ut7}+SŲ̃Ԩܨ ",4<DLT\cks}éΩ٩&2>JVbnz˪֪    )M P Ј   `     @ `  P  `  p  B H ## # 58h! %@) HF  PLV  X_` `l hs= %p %x   % % e@ d  ޼0 ׽@ n  ȝ޽ %Нͱ M؝9  zp ' %T %&@ %4Y i$ FT0 c9 % `P7 (T?= %0tn0A 8gyY %@Pp  H~|  P40s  X[ `l h  p Mxľߗ Mɵ0 @  @       v &D K %QhP %ȞmoОS؞Lo|۸wo@$od2o (0˿8տ@T HpQ P hK X 7` ` =P hDP phD@ xL TA \A ,L?-(8HXh      , 8 ` l $4DT`p !4"p#$%&,'X()*+0,H-d---..d//012$3<4P5d6t789:;<=L>?@[T\|\]^<^_`{{\|}}~, W[_cgkoux  ː        ߔ: !" #,$8%E&O'Z(k)}*+,----..U/c/0C12345i6789:;<=>!?/@=[Q\[\k]^^_`{{|}}H~ i      @  #   P  P @e  e        @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  0   P  #    p#  # #                               ` 0  P  P`   @ R  P                              `   @    P  P @e  e           ` P  p            ` p  0 p    0   p P p  P  о  ` p  @ з 0 p     P P   p  p        @ @ @  @ @ @  #  @ @   @  @ @e  e     @  @  @ @ @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 0  d  P @T !^8 bash.debugNV.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink 44HH !hh$4o 6> 7@F;No޼<[ohhMj N@s XXN8 |T0wT @@a|g g  x :3ܳ (M        (   C H ,N H H